SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MS48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G1MS48
Domain Number - Region: 39-160
Classification Level Classification E-value
Superfamily E set domains 0.000532
Family Arrestin/Vps26-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1MS48
Sequence length 336
Comment (tr|G1MS48|G1MS48_MELGA) VPS26, retromer complex component B {ECO:0000313|Ensembl:ENSMGAP00000001087} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=VPS26B OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MSFFGFGQSAEVELVLSDAESRRRVEHKTEEGKKEKYFLFYDGETVSGRVILTLKHPNRR
LEHQGIKVEFIGQIELYYDRGNHHEFVSLVKDLARPGEFTQSQIFDFEFTHVEKPYESYT
GQNVKLRYFLRATVSRRLNDVVKEMDIVVHTLSTYPELNSSIKMEVGIEDCLHIEFEYNK
SKYHLKDVIVGKIYFLLVRIKIKHMEIDIIKRETTGTGPNVYHENDTIAKYEIMDGAPVR
GESIPIRLFLAGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR
KSMSHQAAIASQRFEGTSSHTEAKTPSQPAENNGRQ
Download sequence
Identical sequences F1NPH4 G1MS48
ENSGALP00000002310 XP_003212753.1.16129 XP_021231648.1.32913 XP_417878.1.86415 ENSMGAP00000001087 ENSMGAP00000001087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]