SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MSN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MSN4
Domain Number 1 Region: 195-415
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-61
Family DBL homology domain (DH-domain) 0.0000411
Further Details:      
 
Domain Number 2 Region: 405-542
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000042
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 549-615
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000361
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1MSN4
Sequence length 635
Comment (tr|G1MSN4|G1MSN4_MELGA) Rho guanine nucleotide exchange factor 16 {ECO:0000313|Ensembl:ENSMGAP00000001348} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=ARHGEF16 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
EPRRIVLSTDSPAALKVGTQQLIPRSLAVSTKTKNPTRNPSAGSIPDAACSGQKRASVPS
ITLQEGTEEDGGGMLKRNLRNMSYRAAMKGTGTEMEPVSTVPTLKPLLEEGSAPPARSPG
RSKRTLGRKRVQKHGGSFKDQPRLYQEIRERGLNSVSHESDEDLLEEPSPEEPSPPGAAI
VVRSYRPAQVTWSQLPEVLEAGLLEAIKPEERKRQEAMFEIITSEFSYMHSLTVLVGCFK
KSEELKETMTQTEHHHLFSNISDILAVSTNFFQALEKRHQENVLIPDISDIVEEHASKHF
NPYISYCSNEVYQQRTLQRLLNTNPLFKEALKQIERKPECGGLPLISFLILPMQRVTRLP
LLLDTVCQKTQACTAAYGAATRALKAISKLVKNCNEGARAMERTEQLCTLQKQLEFGKKK
PFPLISASRWXKRGELYLLSSEEGGIFRKGSGRVCHLFLFNDVLIITKKKSEESYTVMNY
AMLDQVSVEKMEPTEPPSPPPGRPGGHLLRVAMERDSEGRREEVLLSAETLSDRARWVTA
LMHREREQPDSTPRGDLSQVEITRAYMAKQADEISLQQADVVLVLGEEDGWCWGERLRDG
ERGWFPQACARPITSRVAVECNVRRMERLRIETDV
Download sequence
Identical sequences G1MSN4
ENSMGAP00000001348 ENSMGAP00000001348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]