SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1MTH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MTH8
Domain Number 1 Region: 327-494,575-749
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.06e-127
Family Mammalian PLC 0.000000903
Further Details:      
 
Domain Number 2 Region: 171-326
Classification Level Classification E-value
Superfamily EF-hand 4.64e-45
Family EF-hand modules in multidomain proteins 0.07
Further Details:      
 
Domain Number 3 Region: 767-882
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.53e-27
Family PLC-like (P variant) 0.00068
Further Details:      
 
Domain Number 4 Region: 41-154
Classification Level Classification E-value
Superfamily PH domain-like 4.67e-27
Family Pleckstrin-homology domain (PH domain) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1MTH8
Sequence length 1433
Comment (tr|G1MTH8|G1MTH8_MELGA) Phosphoinositide phospholipase C {ECO:0000256|RuleBase:RU361133} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=PLCH2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
AMDAIGSPLLQNKFSVARLAEEFFWVGGSIVASPRWKIGRFVERCMSSMQAGTQMIKLRG
GSKGLVRFYYLDEHKSCIRWRPSRKNERAKISIDSIQEVCEGKQSEIFQRYADGSFDPNC
CFSIYYGDHMESLDLVSSSGDEARTWITGLKYLMAGISDEDSLSKRQRTRDQLWLKQTFD
EADKNGDGCLSINEVLQLMHKLNVNLPRQKVKQMFKEADTDDNQGTLGFDEFCTFYKMMS
TRRDLYLLMLTYSNHKDFLDTDDLRRFLENEQKMTNVTREHCLEIINKFEPCLENKKTGA
LGIDGFTNYMRSPSGDIFNPEHYQVHQDMNYPLSHYFITSSHNTYLMGDQLMSQSRVDMY
AWVLQSGCRCVEVDCWDGPDGEPIVHHGYTLTSKILFKDVIETINKYAFIKNEYPVILSI
ENHCSVIQQKKMAQYLTEILGDKLDLSSVHNDDSTRLPSPASLKGKILVKGKKLPANISD
DAEEGEVSDEDSADEIDDDCKIMNGDASTNRKRVENIAKKKLDSLIKESKIRDCEDPNNF
TVTTLPSSGKTGQKSNKLEDDVESGEDFSTNKRHSRTLMGSFSKRKKKGSKLKKSTSLEE
GEDDADSQGNVARGSVHYTRVNRQKKTMKLSRALSDLVKYTKSVGIHDVESEISSSWQVS
SFSETKAHQILQQKPAQYLRFNQHQLSRIYPSSYRVDSSNYNPQPFWNAGCQLVALNYQS
EGRMLQLNRAKFSANGNCGYVLKPDCMCQGIFNPNSEDPLPGQLKKQLILRIISGQQLPK
PRDSMLGDRGEIIDPFVEVEVIGLPVDCFKEQTRVVDDNGFNPMWEETLVFTLHMPEIAL
IRFLVWDHDPIGRDFIGQRTIAFSSMMPGYRHVYLEGIEEASIFVHVAINDICGKVKQAL
GLKGLFLRNPKQASLDSHAAGQLHRKHSFSSHILRRTASAPTKSQKKKKGFPEIVFDTKD
NSSEGASEDHEAEAASQPCFAQEPERSGSGSTRVDVSHFSMQRSVTSLCSLETITEEPVI
ANESHHASLFFPLPITPYSDSEEGSMSDHSTESQTKASNPLNWPPEPLLTREQRPNLAAE
DHIFQKAQAAQALPVSQTSSYMLIRKSKSEGLKKSDSSALIKNPSSLSPAAEVYFDATVN
DRIWSKLDCSNHRDSMSSSSSMSSNDTVIDLSLPNLARKSLPDLGIRHENFEPLAMRRGI
RPRSATTSGNEMSVVSKSKSNPNLRSDQLPADELCPRPLARSPQDAFSSIPRRHTWSRLY
IESLRQSSNKSKAQDKVGNNQVKSKSLGDLTSDDIVCTFESKYRSISRSFVTRSMREQRR
SAGLRTSVKPQDELTEQLKRLTAFQQENDITSPISLDPTESEEEAESLGLLRRSSSRSQS
RVRYIANRAKQAQERQRLQSLGQLSGSPIEERGNPEGACSVAKAVCMDIASPA
Download sequence
Identical sequences G1MTH8
ENSMGAP00000001713 ENSMGAP00000001713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]