SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MTZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MTZ7
Domain Number 1 Region: 23-143
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.15e-45
Family Frizzled cysteine-rich domain 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1MTZ7
Sequence length 572
Comment (tr|G1MTZ7|G1MTZ7_MELGA) Frizzled class receptor 10 {ECO:0000313|Ensembl:ENSMGAP00000001940} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=FZD10 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
XLCWLAERCAGISSIDIERPGDGRCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLH
EFAPLVEYGCHSHLKFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWP
DSLDCSKLPNKNDPNYLCMEAPNNGSDEPPRGSSMLPPMFRPQRPSSGHDLQQHKDSLSR
TSCENPGKFHHVEKSASCAPLCTPGVDVYWSKDDKQFAVIWIAIWSILCFFSSAFTVLTF
LIDPQRFKYPERPIIFLSMCYCVYSVGYIIRLFSGAESIACDRDSGQLYVIQEGLESTGC
TIVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMI
LVMRRVAGDELTGLCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMKT
GGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDYWKIVATQQKCKMNNQTKN
LDCMMNNSIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQNVCSRRLKKRSRRKPAS
VITSSGIYKKPQHPQKTHLAKYESTLQPPTCV
Download sequence
Identical sequences G1MTZ7
ENSMGAP00000001940 ENSMGAP00000001940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]