SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MUD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MUD7
Domain Number 1 Region: 55-263
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.83e-40
Family Protein prenyltransferases 0.000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1MUD7
Sequence length 263
Comment (tr|G1MUD7|G1MUD7_MELGA) Protein geranylgeranyltransferase type I subunit beta {ECO:0000313|Ensembl:ENSMGAP00000002131} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=PGGT1B OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
RKDSINLGHSYSKANWFNLYFLSFPESNLNRCGFRGSSYLGIPFNPSKGSDVSHPYDSGH
IAMTYTGLSCLLILGDDLSRINKDALLAGLRALQLEDGSQQFLHLEVHQASGGASGIWRC
LFHCSERSCYRYWTTSVVEKSLPYPKSNSIHPHLSCRGDGLASLGGGSTFCGIASLCLMG
KLEEVFSEKELSRIGRWCVMRQQNGYHGRPNKPVDTCYSFWVGATLKLLNLFQYTNFEKN
RNYILSTQDRLVGGFAKWPDSHP
Download sequence
Identical sequences G1MUD7
ENSMGAP00000002131 ENSMGAP00000002131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]