SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MUH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MUH1
Domain Number 1 Region: 206-480
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-85
Family Protein kinases, catalytic subunit 0.000000000258
Further Details:      
 
Domain Number 2 Region: 95-235
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-38
Family SH2 domain 0.00000238
Further Details:      
 
Domain Number 3 Region: 35-120
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-20
Family SH3-domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1MUH1
Sequence length 1098
Comment (tr|G1MUH1|G1MUH1_MELGA) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=ABL2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
EALHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEK
LRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLING
SFLVRESESSPGQLSISLRYEGRVYHYRINTTSDGKVYVTAESRFSTLAELVHHHSTVAD
GLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYNLT
VAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYL
RECNREEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRL
MTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQ
VYDLLEKGYRMEQPEGCPPKVYELMRACWKWNPPDRPSFAETHQAFETMFHDSSISEEVA
EELGRTASSSSIVPYLPRLPMLPSKTRTLKKQAENKENIEGTQDTLEHSASSSAPGLIRS
TQPTTGSPALPHKQRDKSPSSLLEDAKETTFTRDRKGGFFSSFMKKRNAPTPPKRSSSFR
EMENQPHKKYELTGNFSSVASLQHVDGFAFAPTQQDTNLAPPKCYGGGFVQRTFYNDDGT
GTSSGGGVSTGGGWSGITGFFTPRLIKKTLGLRPGKPTGNEEASKPFPRSNSTSSMSSGL
PEQDRMAMTLPRNSQRSKIQLERTVSTSSQPDESTGRANDLLPKRFEEGSALTRERPKAK
LLPRGAAALPFRTPSSSEEKEIPGLAATPKSKEKNSGPRQGALEDGERPGWSSPVKAAAI
LPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDRDRPRRVKPKC
APPPPPVMRLLQQPAACSDAAEELSNASGAQHGLESSEGSKKAAAAPVSGKSGRPMMPPP
QVPLSSSSTSPVKMANGTAGAKIALRKTKQATEKIPADKISKEALLECADLLSSAIAEPT
PNSQLVDTGHQLLDYCSGYVDCIPHTRNKFAFREAVSKLELSLQELQVSSTAASIPGANP
VLNNLLSCVQEISDVVQR
Download sequence
Identical sequences G1MUH1
ENSMGAP00000002179 ENSMGAP00000002179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]