SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MV66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MV66
Domain Number 1 Region: 989-1339
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.43e-87
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000604
Further Details:      
 
Domain Number 2 Region: 808-986
Classification Level Classification E-value
Superfamily ARM repeat 1.27e-55
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00023
Further Details:      
 
Domain Number 3 Region: 321-477
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.86e-32
Family Ras-binding domain, RBD 0.006
Further Details:      
 
Domain Number 4 Region: 642-789
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.36e-31
Family PLC-like (P variant) 0.012
Further Details:      
 
Domain Number 5 Region: 1367-1495
Classification Level Classification E-value
Superfamily PX domain 3.27e-27
Family PX domain 0.0011
Further Details:      
 
Domain Number 6 Region: 1506-1633
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.66e-25
Family Synaptotagmin-like (S variant) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1MV66
Sequence length 1637
Comment (tr|G1MV66|G1MV66_MELGA) Phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta {ECO:0000313|Ensembl:ENSMGAP00000002505} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=PIK3C2B OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
ARLGSDPRAMSATRGNGEHWKSLESVGISRKELALAEALQMEYDALSRLRQDKEESRAKQ
RAEPPLISWDEPENTHGCTGIKATRGLSGSDPALCNNAAPEGLTPALPTPPPQPNAAPTG
TEGPGWLKTPLAGDYLYIFDGSEGDFLGEPLNGTSPLDSNGGSPKKLSPPPLPPRNSVRS
HPEGSRRLGKGSPPSSKGPQPRDVNVFSAHEQPRGKLLARRISEEDPYGLADYEGINDAI
TCLNLKSTYESQVLREAARSWKEGRSIFEKESSGKPVARSKTMPPQVPPRTYVSRFGNRK
NVAPNKNRRISADPVPPRPRSLANGYELFEVSEERDEEVAAFCHMLDVLRSSSSPQDYSL
TGFVWSAVSLSPEHLGHGISLKVTVLCDSLQEPLTFTCDCSSTVDLLIYQTLCYTHDELH
TVDVEDFVLKLCGLEEFLQNKHALGSHEYIQHCRKFDIDIRLQLMRRKAVRSDLARTASD
DQSPSTLNHYIHLQERPIKQTISRQALSLLFDTFHNEVDTFLAAEGDFPLKAERVIQSVM
AICNALAAVESQEITTALNQMPPCPSRMQPKIQKDPNVLAKRENRERIVESLTAAILDLV
GLYCSTFNADFQTAVQWSREHGVVQEARLLSCPLSFTVYATHRIPITWAASYEDFYLSCS
ITHGGKELCSPLHTRKAHVYKYLFHLIIWDQQICFPVQVNRLPRETLLSVTLFAVPVPPP
GSSSDTNRQRRVPEALGWVTTPLFNFRQVLTCGRKLLGLWPATQDNSRARSSAPNFNQPD
SVILQIDFPTSAFDVKFVSPLAAEVSPKYEFGSLGEEDQRRLREAMQKKSLYWLTDADRK
RLWEKRYYCHAAPGSLPMLLASAPSWEWACLPDIYALLSQWTYMSHQDALGLLHATFPDQ
EVRRTAVQWIDSISDTELLDYLPQLVQALKYECYLDSPLVRFLMKRAICDLKITHYFFWL
LKDGLKDSQFSIRYQYLLAALLCCCGKGLREEFDRQCLLVNTLARLAQQVRDAAPSARQG
ILREGLEEVKQFFKANGSCRLPLSPSLLVKGIVPRDCSYFNSNAVPLKLSFQNVDPLGEN
IRVIFKCGDDLRQDMLTLQMIRIMNKIWVQEGLDMRMVIFRCFSTGRGRGMVEMIPNAET
LRKIQVEHGVTGSFKDRPLADWLQTQSPKEFGVEEAVKPQVWSCAGCCVATYVLGICDRH
NDNIMLKTTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDF
VDLCCQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTDADATTYFT
RLIESSLGSVATKLNFFIHNLAQMKFTGSDARPTLSFAPRTHTIKTSGRICDVFLCRHER
VFNPSKGYTYVVKVKRESPSEVTFVQRTFEEFQELHNKLRLLFPSSLLPSFPSRFIIGRS
RGEAVAERRKEELNGYIWHLIHAAPEVAECDLIYTFFHPLPRDEKAAGTNPAPKPADTTW
ARPLGKVGGEVKLSISYKNNKLFIMVMHIRGLQPLQDGNDPDPYVKTYLLPDPQKTTKRK
TKVARKTCNPTYNAQLVYDGVPRGDLQQRELRLSVLSEEGFWENILLGEVGIRLRDLDLA
QEKMGWFALGSRGHGTL
Download sequence
Identical sequences G1MV66
ENSMGAP00000002505 ENSMGAP00000002505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]