SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MVU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MVU5
Domain Number 1 Region: 115-417
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.29e-116
Family Pancreatic carboxypeptidases 0.000000045
Further Details:      
 
Domain Number 2 Region: 21-107
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 5.1e-26
Family Pancreatic carboxypeptidase, activation domain 0.0000498
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1MVU5
Sequence length 421
Comment (tr|G1MVU5|G1MVU5_MELGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMGAP00000002795} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=CPA2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
STMKLILIFSALFGAALCLETFVGHQVLRIKTRNEEQLQKLQFLETLDHLELDFWLNPST
PALPVDVRIPAHSLQAVKVFLESHGIEYSILIEDLQVVLDREKRDIVASQQMERSSSTFN
YGTYHSLASIYQELDNLASEYGNIVSKIQIGESYEKRPLYALKFSTGRGNRPAIWLDAGI
HSREWVTQASAMWIARKIASDYGNDPSTTSLLNNLDIFLLPVANPDGYEFTHTTNRMWRK
TRSKNSGSLCIGVDPNRNWDAGFGGPGASSNPCSDSYRGPSANSEVEVKSVVNFIKNHGN
IRAFLTLHSYSQLLMYPYGYKCTPPADNAELNTIGKAAANSIQSLHGTTYTVGSICTTIY
QASGGSIDWSYDYGIKYSFAFELRDTGRYGFLLPAAQIIPTAEETWLGLKTIMEYVRDNP
Y
Download sequence
Identical sequences G1MVU5
ENSMGAP00000002795 ENSMGAP00000002795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]