SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MWN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MWN3
Domain Number 1 Region: 256-526
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.16e-83
Family Protein kinases, catalytic subunit 0.000000000096
Further Details:      
 
Domain Number 2 Region: 113-287
Classification Level Classification E-value
Superfamily SH2 domain 6.38e-39
Family SH2 domain 0.00000475
Further Details:      
 
Domain Number 3 Region: 79-121
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000349
Family SH3-domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1MWN3
Sequence length 533
Comment (tr|G1MWN3|G1MWN3_MELGA) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=SRC OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MGSSKSKPKDPSQRRRSLEPPDSTHHGGFPASQTPNKTAAPDTHRTPSRSFGTVATEPKL
FGGFNTSDTVTSPQRAGALAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWL
AHSLTTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNPENPRGTFLVRESETT
KGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFGSLQQLVAYYSKHADGLCHR
LTNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPG
TMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGKYLRL
PQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQ
GAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYR
MPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
Download sequence
Identical sequences G1MWN3
XP_003212004.1.16129 XP_019477708.1.16129 ENSMGAP00000003185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]