SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MWU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MWU2
Domain Number 1 Region: 531-772
Classification Level Classification E-value
Superfamily VPS9 domain 3.27e-54
Family VPS9 domain 0.0011
Further Details:      
 
Domain Number 2 Region: 90-195
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000337
Family SH2 domain 0.0032
Further Details:      
 
Domain Number 3 Region: 789-865
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000956
Family Ras-binding domain, RBD 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1MWU2
Sequence length 891
Comment (tr|G1MWU2|G1MWU2_MELGA) Ras and Rab interactor 2 {ECO:0000313|Ensembl:ENSMGAP00000003252} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=RIN2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MSSLTMKAHCRDKRGSFFKLIDTIASEIGELKQEMVQTDVTVEDEPADLRSLVKNMDNVS
PEKKDVKGCPRDSGYDSLSNKLSILDKLLHTHPVWLQLGLNDAEATEILRAQPPGIFLVR
KSSKLLKKVISLRLPGDCGPCLKEFAIKESTYTFSLEGSGISFADLFRLIAFYCISRDVL
PFTLKLPHAIAAAKTEAELEEIAQLGLNFWSSPANSSPSDASPPRKPGPSDSACKDSRQL
CLINGVHSIRTRTPLELECSQTNGALCFINPLFLKVHSQDVTGSLKRQSLKSQDVNGTER
PRSPPPRPPPPSINSVLMSPQLSRTIKQTSVPETVNHKKERDLDLLQSKPTPIPPPRLKK
QAVCAEVEGGSSKPAAAIQPACNSVRVPAAADVVGETPPPQPAPAASKKTAVSSSESHVP
WNGGRQRLSDMSISTSSSDSLDFDRSMPLFGYEGDTNSSLEDFEGESDQESMAPPLKPKK
KRNSSFVLPKIVKSQLRKVSGVFSSFMTPEKRMIKKIAEMSRDKRTYFGCLVQDYISFLQ
ENKECHVSSTDMLQTVRQFMTQVKNYLSQSSELDPPIESLIPEDQIDVVLEKAMHKCILK
PLKGHIEAMLKEFHTADGSWKQLKENLQLVRQRNPQELGVFVPTPDFVDVEKIKVKFMTM
QKMYSPEKKVMLLLRVCKLIYTVMENNSGRLYGADDFLPVLTYVLAQCDMLELDTEIEYM
MELLDPSLLHGEGGYYLTSAYGALSLIKNFQEEQAARLLSSEARDTLRQWHKRRTTNRTI
PSVDDFQNYLRVAFQEVNSGCTGKTLLVRPYITTEDVCQLCAEKFKVDNPKEYSLFLFID
DTWQQLTEDTYPQKIKAELHSRPQPQVFHFVYKRINSDPYSAIFQNDDSAS
Download sequence
Identical sequences G1MWU2
ENSMGAP00000003252 ENSMGAP00000003252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]