SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MXI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MXI6
Domain Number 1 Region: 2-415
Classification Level Classification E-value
Superfamily Sema domain 2.09e-149
Family Sema domain 0.000000000271
Further Details:      
 
Domain Number 2 Region: 472-558
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000131
Family I set domains 0.087
Further Details:      
 
Domain Number 3 Region: 411-451
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000488
Family Plexin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1MXI6
Sequence length 659
Comment (tr|G1MXI6|G1MXI6_MELGA) Semaphorin 3G {ECO:0000313|Ensembl:ENSMGAP00000003557} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=SEMA3G OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
PQTDCANYVRLLQPYNRTHLLACGTGACHPVCTFIYVGHRGETQHAFNLDPGSMESGRGR
CPHEPDRAFASTIIGGELYAGLTADFLGRDPGIFRSTGTRAALRTEVDQRLLNDPKFVAA
YMIPDNDDQDDDKAYFFFTEKVVEADSKEHTIVSRVARVCVNDAGGQRVLVNKWSTFNKA
RLVCSVPGPGGIDTHFDELEDVFLLRTKDGKNPEIYALFSTVSHVFQGSAVCVYRMADIR
EVFNGPFAHRDSPLHQWGAYEGRVPYPRPGVCPSKTTNQPQRPYRSTKELPDEVLHFARA
HPLMYRPVRPRHHRPLLVKTDLQHGLRQLVVDRVDTEDGQHDVLFLGTDAGSVLKVVVLQ
KQSSAVTEEVVLEELQVFKVPVPITQMEISVKRQKLYVGASLGVAQVRLHQCKSYGTACA
ECCLARDPYCAWDGTACTRYQPSGKRRYVRHTSSVHQCLDQNLTVDDLEHVEEKVLYGME
HNSTFLECVPRSPQASVQWFVQRPPDEQRDEVKTDERVLQTEQGLLFRQLHRRDAGIYYC
KTLEHGFTQTVAKTALEVLGGEQLARATPRQREDRHPLCPEPWLAAPAPKTWYKDILHLA
SSADRQRVEEQCLRLWCGHRKGKMAKGKHALAGMDVGKKGRVAKPQGERIRVPRQAAAT
Download sequence
Identical sequences G1MXI6
ENSMGAP00000003557 ENSMGAP00000003557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]