SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MXM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MXM0
Domain Number 1 Region: 827-954,1150-1339
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.4e-52
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 2 Region: 430-512
Classification Level Classification E-value
Superfamily E set domains 2.57e-16
Family Other IPT/TIG domains 0.056
Further Details:      
 
Domain Number 3 Region: 329-424
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000131
Family Other IPT/TIG domains 0.0053
Further Details:      
 
Domain Number 4 Region: 513-616
Classification Level Classification E-value
Superfamily E set domains 0.000000000000021
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.047
Further Details:      
 
Domain Number 5 Region: 283-316
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000183
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 613-701
Classification Level Classification E-value
Superfamily E set domains 0.0000476
Family E-set domains of sugar-utilizing enzymes 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1MXM0
Sequence length 1369
Comment (tr|G1MXM0|G1MXM0_MELGA) Plexin A4 {ECO:0000313|Ensembl:ENSMGAP00000003604} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=PLXNA4 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
WCPYHSLLRCTRKERCERSSEPRRFASEMKQCVRLTVHPNNISVSQYNVLLVLETYNVPE
LSAGVNCTFEDLSEMDGLVVGSQIQCISPAAKEVPQIITENGDHHIVQLQLKSKETGMTF
ASTSFVFYNCSVHNSCLSCVESPYRCHWCKYRHVCTHDPSTCSFQEGRVKLPEDCPQLLQ
AEKILVPVEVIKPITLKAKNLPQPQSGQRGYECILNIQGNEQRVPALRFNSSSVQCQNTS
YSYEGMEINSLPVELTVVWNGNFNIDNPAQNKVHLYKCGAMRDSCGLCLKADPDFECGWC
EGQNQCTLKQHCPAQDSQWLELSSTKGKCTNPKITDINPVTGPREGGTKVTIRGENLGLE
FRDIASHVKVAGVECKPLVEGYIPAEQIVCEMGEAKPSQHAGFVEICVAECKPEFMARSS
QLYYFMTLTLSDLKPKRGPVSGGTQVTITGNNLNAGSNVIVTFGRQPCLFYRRSTKHIVC
NTTASDEGFEKVKVSVRVDKAKIHQELQYEYVEDPTILRIEPEWSIFSGNTPIAVWGTHL
DLIQNPQIRAKHGGKEHVNNCEVQNSTEMTCQAPALAVDPSHQSELAERPEEFGFILDNV
QSLLILNKTNFTYYPNPIFEVFNPSGILELKPGSPIILKGKNLIPPVAGGNAKLNYTVLV
GEKPCVVTVSDVQLLCESPNLIGRHKVMARVGGMEFSPGMVYISPDSPLSLPAIVSIAVA
GGLLIIFIVAVLIAYKRKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTS
DLDGAGIPFLDYRTYTMRVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFL
LSFIRTLESQRSFSMRDRGNVASLIMTVLQSKLEYATDVLKQLLADLIDKNLESKNHPKL
LLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDSITGEARYSL
SEDKLIRQQIDYKTLVLSCVNPDNVNSSEIPVKILNCDTITQVKEKILDAIFKNVPCSHR
PKAADMDLEWRQASGARMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVALVSKQVTAY
NAVNNSTVSRTSASKYENMIRYTGSPDSLRSRTPMITPDLESGVKMWHLVKNHEHGDQKE
GDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQAD
KHNIHDPHVRHTWKSNCLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTS
EHRLGKDSPSNKLLYAKDIPSYKNWVERYYSDIAKMPAISDQDMNAYLAEQSRMHMNEFN
TMSALSEIYSYVGKYSEEILGALDQDDQAGKQKLAYKLEQVITLMSIDS
Download sequence
Identical sequences G1MXM0
ENSMGAP00000003604 ENSMGAP00000003604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]