SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MYR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MYR4
Domain Number 1 Region: 41-380
Classification Level Classification E-value
Superfamily Sema domain 8.89e-131
Family Sema domain 0.000000000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1MYR4
Sequence length 444
Comment (tr|G1MYR4|G1MYR4_MELGA) Semaphorin 3B {ECO:0000313|Ensembl:ENSMGAP00000004117} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=SEMA3B OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MGMGGGQGGQPGWLVAAATPAPSRGPIGDDEAELRARHGLRLFQLERSCCYEALLLDEER
GRLFVGAKNHLLSLSLDNISQRDRKIYWPAPVEWREECNWAGKDITAECMNFVKILHAYN
RTHLYACGTGAFHPTCAFVEVGQHTEDHIFKLDTRRAEDGKGKSPYDPRHAAASVLVGEE
LYSGVATDLMGRDFTIFRSMGSRPSVRTEQHDSRWLNEPKFVDVFWVPESENPDDDKIYF
FFREMAVERQQGLGKASISRIGQICRNDVGGQRSLVNKWTTFLKARLVCAVPGTDGADTH
FDELRDVFLLQTRDKRNPLVYAAFSTSSSIFQGSAVCIYTMADIRRAFLGPFAHKEGPNY
QWVPYQARVPYPRPGMAPAEPSAPSAPPRTSRMRCTTQCYPTASGPSSCKLACPTPSPAS
PSIVWLPPMATTTSSSLAQMWALC
Download sequence
Identical sequences G1MYR4
ENSMGAP00000004117 ENSMGAP00000004117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]