SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MYZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MYZ0
Domain Number 1 Region: 941-1109
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-44
Family C-type lectin domain 0.00000808
Further Details:      
 
Domain Number 2 Region: 72-188
Classification Level Classification E-value
Superfamily C-type lectin-like 5.78e-39
Family Link domain 0.0026
Further Details:      
 
Domain Number 3 Region: 183-296
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-28
Family Link domain 0.0061
Further Details:      
 
Domain Number 4 Region: 1110-1169
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000306
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 906-948
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1MYZ0
Sequence length 1218
Comment (tr|G1MYZ0|G1MYZ0_MELGA) Neurocan {ECO:0000313|Ensembl:ENSMGAP00000004210} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=NCAN OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
KVRSASGQREDVPILVAKDNVVKVVKAYEGRVSLPGYARDRYNGTLLLRAARASDAGLYR
CEVVAGIDDEQDLLPLEVMGVVFHYRPAGARYALTFAAARRACMDNSAIIASPQHLQAAF
EDGYDNCDAGWLADQSVRYPITLSRPGCYGDRNSLPGVRSYGQREPGELYDVYCYAQELQ
GKVFYATAPGRFTLLGAQRHCRGRGAALATTGQLYLAWREGLDQCDPGWLADGSVRYPIL
APRRKCGGEAPGVRTLYRFPNRTGFPPPTSKFDAYCYKGNKDRPRGHRCVPDSSSPPTPI
PAGDTADAPDSTAEQREQEPLGSDNVLVEREDMATSGDSPRAGVLRQLGAAGPGGAEDEQ
LQLASSVTAAWRGDIPGGSTTASSSSPSSSVWPLEDEALNAVDQAPQGSRQQLFGSSPAA
APREFPDPPDPLFTLHPQTQSPAQEITSSPPALGTVPIVAAETPSTPKQSSYAGLNGRYF
QLQQQSRDPSVAQDPTVADDHTVAGDPAGRVTQAPILALEVKGAAANAVETWSMTHPSAE
SPHRGSPYPLSNEVEEEIGHKLLAPSTIPVPPSQRGLPQWSPSTAPHGRGDPTLTSLPSS
PPTPVAPSDTSHHQDVSTGEAQPRGDSAQPPADVTEDFSGDAAPKEDDSPIPPWPPLPPA
PLVAEGPGTAAQPISDSGTLGDGSLERQRKAVTFILLPMGLPGSPSPTAVSSPHPQSRLS
PTDPQGALEMGAEPTREHLDVGTGLQDEAAVTPVAPDVPSASPTDSEVTPRLGSEWPSEG
SGRVGDGPTAAPQHPNPLSSQGWKPPSPGEEDTSEEAKNEPPASTATHPPAPPDIHWPSP
TAPHPWVPDGPEAPSAGPLFEPTTPGGAGGALLLDADSGSGEEPVLEEQELLVWADSSNS
SQHAPADPCQTNPCLHGGTCHANGSVCGCSCAPGFTGENCEIDIDDCLSSPCQNGGTCID
EVNAFVCLCLPSYGGSRCEKDTEGCDHNWHKFQGHCYRYFSRRRSWEDAERDCRRRAGHL
TSIHSQEEHGFINSFGHENTWIGLNDRIVEQDFQWTDNTGLQYENWRENQPDNFFAGGED
CVVLVSHEIGKWNDVPCNYNLPYICKKGTVLCGPPPEVENAFLVGKKEKYSIHSSVRYQC
EEGFTQRHVPTIRCHSNGKWDRPKLLCTKPRRSHRARRHHRHRHSHPHHQHHHHKPRKER
RKHRKHLRLDWMEEGHYF
Download sequence
Identical sequences G1MYZ0
ENSMGAP00000004210 ENSMGAP00000004210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]