SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MZ48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MZ48
Domain Number 1 Region: 6-93
Classification Level Classification E-value
Superfamily E set domains 8.82e-17
Family Other IPT/TIG domains 0.00000737
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1MZ48
Sequence length 925
Comment (tr|G1MZ48|G1MZ48_MELGA) Exocyst complex component 2 {ECO:0000313|Ensembl:ENSMGAP00000004283} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=EXOC2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MSRARQPPLVTGISPNEGISWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKI
VCRVGQAKNDKGDIIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDR
NKGIPPLSLRPANPLGIEIDKGRFPQKDLEMLFPGMSADFTSENFSAAWYLIENHSTTSF
DQLKMAVVHLKKQANKKSEGSLAYVKGGLSTFFEAQDALSAIHQKLEADGTEKVEGSMTQ
KLENVLNRASNTADTLFQEVLGRKDKADSTRNALNVLQRFKFLFNLPLNIERNIQKGDYD
VVINDYEKAKSLFGKTEVQVFKKYYAEVETRIEALRELLLDKLLETPSTLHDQKRYIRYL
SDLHAPGDPAWQCIGAQHQWILQLMHNCKESYVKEQKGTSLLHSSMLDLDSDVRPSPIGH
LSQTASLKRGSSFQSGRNDAWRYKAPQQVVFVEKLTKLVVSQLPNFWKLWISYVNGSLFS
ETAEKSGQMEKSKKNARQRQNDFKKMIQEVMHSLEKLIRGALLPFSLKEGESRQYGGWEM
KSELSGQWLTHVIQTVRLSSESLTALEIPNDMLQIIQDLILDLRVRCIIVTLQHTAEDIK
RLAEKEDWVVDNEGLTSLPSHFEQCIVHSLQSLKTVLDCKPGEASVFQQQKIQEDVCQLS
IGILQVFIDCLEQLSTKPDGDIDTSHLSVDVSSPDLFGSIHEDSSLTSEQRVLIALSNCR
YLERHTFLNIAEHFEKHGFQGVDKITQVSMESLKELDQRLFEMYIESKADPIVGSLEPGI
YAGYFDWKDCLVPAGVRNYLKEALVNIIAVHAEVFTISKDLVPRVMSKIVEAVSEELSRL
MQCVSSFSKNGALQARLEICALKDTVAIYLTPDSNSSFKQALEALPQISSGADKKLLEEL
LNKFKSSMHLQLTCFQTSSSAMIKT
Download sequence
Identical sequences G1MZ48
ENSMGAP00000004283 XP_003204821.1.16129 ENSMGAP00000004283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]