SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MZC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MZC4
Domain Number 1 Region: 28-497
Classification Level Classification E-value
Superfamily Sema domain 3.92e-163
Family Sema domain 0.000000000707
Further Details:      
 
Domain Number 2 Region: 500-552
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000471
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 563-628
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000302
Family I set domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1MZC4
Sequence length 693
Comment (tr|G1MZC4|G1MZC4_MELGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMGAP00000004382} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN= OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MGASAVVLCLVLQLMQEVKASVGNCIPRKTVKYQTLNVEMFVKEGLSNVSALLVDEETDR
LFVGGRDVISALDLNNISRETAREHWFATQERQLECIRRGKDKIRCQNYILVLHKINDSH
VYVCGTNAYHPLCDHMVIQRTKMHLQGRAEESRGKCPFEPTLKYASVFVDGAFYSATSNN
FLGTEPIILRSMQNPVRTEFKTSWLNEPSFVGMEIVPESEFSPDGDDDKIYVFFTETAVE
FEFYDKILVSRIARICKGDLGGKRLLQRRWTSFLKARLSCSVPELNFHFNIIQDIFFLRR
RKWQDSIFYGIFSQQWGRLDTSAVCAYSMASIREAFSKGSYRGPITVEHSHVRWMVFRGE
VPVPRPGACIDNFARNLGYNTSSDLPDKVLQFARDHPLMDGSVNPIGERPALLKRSSNYT
RIVVDRVTGLDKQTYDVMFLGTDDGYLHKAFNCDGEMFIVEELQLFLSPEPVQFLQLSAK
KGMLYVGALSAVVQLPVSGCQRYKHCLDCILARDPYCAWSQAAQACVLLSDQSADTKNLI
QNVKYGDASSCLSVGIEIGILLNVEFHTGNNVHLKCVPLSNLARVVWKFNGSRIRDEDSK
YLLYDGGIAIFNATAAETGFYDCLSVEKSKAKEFFITVARYALYAQQSTDATKQKSVGSQ
KENLVLKLLCAGFALLFFFLFIWNFYKGHISLP
Download sequence
Identical sequences G1MZC4
ENSMGAP00000004382 ENSMGAP00000004382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]