SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MZL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MZL3
Domain Number 1 Region: 331-434
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000111
Family Spectrin repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1MZL3
Sequence length 466
Comment (tr|G1MZL3|G1MZL3_MELGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMGAP00000004491} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN= OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
SYQADYWACAIPDSLPPSPDRQSPHWNPNKEYEDLLDYTYPLKPKYKLGKVPEPLFHDSG
VDLDSFSLSPEGTFRSTSIYGLGWQDQGRRENQHQGAVASTRRNSTPVAGKAGNAGALSR
YEPSPIAKASLARSASSAGAAGPAGGFAKGLTLSGLARLSSFDCPDVDGGSWCTRNPFSS
HKGKVKSAERFLPTTQVLPLRREWDGDEEFLSLPPRLRELETLSQILSDLSLTIRTPRQS
HWDSPPRSNGLESKWAPFGKVGSRDQRQRTGGPAGLCHPYGWDSTQPSSRINRDPLHRPH
LPASSRAVLEGTRLSRLHAAGCPTEGEQWSESLTQCIKVFCHQLEELICWLYDVADTADG
WVPPMPDAASVRAALHRYLEFRKDVADHRSLTESVLQRGAALLECMASNSPALKDTLGLI
EKQSEELENHAERLYQSVLAAVGPVQGRAAAVHSRQQLRHQRPSGR
Download sequence
Identical sequences G1MZL3
ENSMGAP00000004491 ENSMGAP00000004491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]