SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1MZN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1MZN8
Domain Number 1 Region: 130-277
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.25e-32
Family UAS domain 0.027
Further Details:      
 
Domain Number 2 Region: 316-444
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.78e-20
Family UBX domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1MZN8
Sequence length 446
Comment (tr|G1MZN8|G1MZN8_MELGA) Fas associated factor family member 2 {ECO:0000313|Ensembl:ENSMGAP00000004523} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=FAF2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
SGWGEGRDLFRHREKVARKCSKDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGVPS
VFNPPPSRPLQVNTADHRIYSYVVSRPQPRGLLGWGYYFIMLPFRFTYYTLLDIFRFALR
FIRPDPRSRVTDPVGDIISFIHMFEEKYGRIHPVFYQGTYSQALNDAKRELRFLLVYLHG
DDHQDTDEFCRNTLCVPEVVALINTRMLFWACSTNKPEGYRVSQALRENTYPFLAVIMLK
DRRMTVVGRLEGLIQADDLINQLMFIMDANQTYLVSERLEREERNQTQVLRQQQDEAYLA
SLRADQEKERKKKEERERKKKKEEEVQQQKLAEERRRQTLQEEKERKSECLPPEPHPDDP
ESVKIIFKLPNDSRVERRFHFTQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCLPTEE
WPNPPTLQEAGLSHTEVLFVQDLTDD
Download sequence
Identical sequences G1MZN8
ENSMGAP00000004523 ENSMGAP00000004523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]