SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N163 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N163
Domain Number 1 Region: 201-492
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 9.03e-95
Family Cryptochrome/photolyase FAD-binding domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 4-174
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 7.06e-42
Family Cryptochrome/photolyase, N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1N163
Sequence length 534
Comment (tr|G1N163|G1N163_MELGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMGAP00000005212} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=LOC100551128 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MRHRTIHLFRKGLRLHDNPALLAALQSSEVVYPVYILDRAFMTSSMHIGALRWHFLLQSL
EDLRSSLCQLGSCLLVIQGEYDAVVRDHVQKWNITQVTLDAEMEPFYKEMEANIRALGEE
LGFEVLSLMGHSLYNTQRILELNGGTPPLTYKRFLHILSLLGDPEMPIRNLTAEDFQRCS
PPELCLAECYRVPLPTDLKIPPESISPWRGGESEGLQRLEQHLADRFQGWVASFTKPKTV
PNSLLPSTTGTTGLSPYFSMGCLSVRSFFYRLSNIYAQAKHHSLPPVSLQGQLLWREFFY
TVASATPNFTKMAGNPICLQIRWYEDAERLHRWKTAQTGFPWIDAIMTQLRQEGWIHHLA
RHAAACFLTRGDLWISWEEGMKVFEELLLDADYSINAGNWMWLSASAFFHHYTRIFCPVR
FGRRTDPEGQYIRKYLPILKNFPSKYIYEPWTASEEEQKQAGCIIGRDYPFPMVDHKEAS
DHNLQLMKQVREEQYRTAQLTRDDADDPMEMKLKRDHSEENLTKTKAARMTKQT
Download sequence
Identical sequences G1N163
ENSMGAP00000005212 ENSMGAP00000005212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]