SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N210 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N210
Domain Number 1 Region: 3247-3415
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.84e-30
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 3422-3598
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.22e-26
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 2836-3029
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-17
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 4 Region: 3035-3204
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.66e-16
Family Laminin G-like module 0.029
Further Details:      
 
Domain Number 5 Region: 2642-2827
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000744
Family Laminin G-like module 0.043
Further Details:      
 
Domain Number 6 Region: 1880-1935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000212
Family Laminin-type module 0.0022
Further Details:      
 
Domain Number 7 Region: 1833-1882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000301
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 8 Region: 202-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000865
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 9 Region: 445-493
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000977
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 10 Region: 1340-1388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 11 Region: 581-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000156
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 12 Region: 1430-1481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000234
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 13 Region: 261-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 14 Region: 1479-1522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000725
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 15 Region: 1774-1815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000753
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 16 Region: 1981-2030
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000218
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 17 Region: 536-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 18 Region: 678-728
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 19 Region: 1934-1978
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family Laminin-type module 0.0044
Further Details:      
 
Domain Number 20 Region: 331-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000753
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 21 Region: 628-675
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000232
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 22 Region: 398-439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000446
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 23 Region: 491-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 24 Region: 1734-1776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000698
Family Laminin-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1N210
Sequence length 3598
Comment (tr|G1N210|G1N210_MELGA) Laminin subunit alpha 5 {ECO:0000313|Ensembl:ENSMGAP00000005615} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=LAMA5 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
QGQYCDICSSANSNKAHPITNAIDGTERWWQSPPLSRGLEFNQVNVTLDLGQLFHVAYVL
IKFANSPRPDLWVLERSTDFGLTYEPWQYFASSKRDCIEKFGLQTVDRITKDDHAICTTE
YSRIVPLENGEIVVSLVNGRPGAMNFSYSPLLRNFTKATNIRLRFLQTNTLLGHLMGKAL
RDPTVTRRYYYSIKDISIGGRCVCHGHADVCDAKDPSDPYRLQCDCQHNTCGGSCDRCCP
GFNQFPWKPATADSANECQPCNCNGHAYDCYYDPEVDRHKASKSREDKYEGGGVCIDCQH
HTTGVNCERCIPGYYRSPDHPIDSPYICYRCNCKSDFTDGTCEDLTGRCYCKPNYTGEHC
DACAEGYLDFPTATTAVPAFAYNDTGEQVLPAGQIINCDCYAGGTEGNACRKDPRVGMCV
CKPNFQGTHCDQCTPGHYGPLCQPCQCSGPGQYDGTCDSETGQCLCRTGFEGHSCDQCAP
GYFNYPLCQLCGCSAVGTLPGGCDSSGRCFCRAEFTGPRCEQCSSGHHSYPHCYACSCDS
RGAVDNNCSPAGQCRCHVNFAGHTCNQCALGFYGYPSCTPCQCSREGSLHSTCDQETGQC
SCRPKVTGLRCDSCVPGAYGFPHCEVGSCNPAGLVTADPSLAPGSCACRAYVEGPACDRC
KPLYWNLTPDNPYGCTSCKCETKGTISGIAECQQGNGQCFCKPNTCGQFCSACKDGYFSM
ENANYFGCQGCRCDVGGSLGPSCEERSGACRCRQNTRGPTCTQPVRDHYFPDLHHLKFEL
EEGTTPAGRAVRFGYNPLEFEGFSWRGYAQMSSIQPKVVVTLNVTSPDLFRLVFRYVSRG
SASVEGRVSVVEEGKFNICGNCTEQSKQIVFAPSTEPAFVTVPQNSFGEPFVLNPNTWSL
IVEAEGVLLDYLVLLPSSYYEAPILQLKVTDPCTYQPAPEQATQNCLLYKYLSLDGFPAV
AGVDAVCRLDNRLPRGCPTEQLTPSHPWMAMCSGNDVEVQLSLPVAQPGKYVLVVEYANP
NALHLVGVAISSPHLAMQQGTFTFYPCVYSFLCRGVAVDSQSRLATFELTSEATIRFIAD
LADFFLHKVYLAPAEQFTMEFVEPKVHCISVHGMFSSNSSSCIPSRFLKLSQSVVLEGAQ
ALPLAPDVPLAQAVHVAPTGVPLEPAPRPPTAMDSTTELILLQPPQAAVVFNSRIQNLGR
YAFVLHYYQPSHPTFPVEVLINGGRIWQGQTNATFCPHGYGCRSLVVAEDQIVLDVTDND
LMVVVRVPEGKQLWLDYILVVPEDSYNSQYLQEEPLDKSYDFISSCGINSFYINPSTSSR
FCRDSAISLSLFYNNGAQPCQCHEAGARGSQCEPFGGQCPCKSNVIGRECSRCATGYWGF
PNCRPCDCGTRLCDEVTGQCICPPHTLKPECVVCEPQTFGCHPLIGCEDCNCSQPGVQEL
TELGCDVDSGQCKCKPNIIGRRCDLCAPGYYHYPSCRRCDCHPDGTEASVCDPVTGQCHC
KENVEGPRCDQCRKGGAQFSSGFIRMCVRLCPVGIFSATLRIALLSISIQMPSVAPPEHK
FIDMNGWLLMSSDRQEVPTALSLREQLLRADLRNLLDAYQELYWVAPSSYLGDRVSSYGG
HLRYELHSDPRRGDVFIPMESRPDVILKGNQMSIMFLEGSYPSPGEVHEGRLQLVESNFR
HTETHNPVSREELMMVLANLEQLQIRALFSQLSSSVSLRRVVLEIATDTATGVPASNVEL
CFCPANYLGDSCQECAPGYYRDTKGLFLGKCIPCHCNGHSDQCLPGSGICLNCQHNTEGD
HCEQCKDGYVGSHSADGSLQCVGCPCPLSIASNNFAIGCVHKGSSTQCLCKPGYAGPNCE
RCAPGYYGNPLVIGSSCQPCDCSGNTDPNMLFSSCDSLTGTCTGCMHHTAGARCEVCAPG
FYGDAVAAKNCTKCNCSPCGTDSCHPQTGQCFCKAGVTGQHCDHCEEGYYGFEGCSGCRR
CDCDVGAMGSSCHAQTGQCHCLPGVSGLHCQQCAPGYWGFSDRGCRKCECRGGSCDPRTG
ECTCSNGLTGKQCDVCMHNYEIPVANGPDSMRCEVCDSCVLLLLEDLQSIEMSFPSIRSQ
LVNLSASSIAWARLHSLNSTMATVANQLREYHRAMNKVRQRADELEDENIDLTQDLNALQ
HRMMMTHRKASHLEQHTRETYQRGEQLLLTIQSIQKSTGDLVRQMATFGAANASTTSTEE
FRQKMAEVERMLREMKERSLGGQEELARREHKEAQKLLHRVKSELHAHWESNQALMSSIQ
DWLAQHSSQLMDLRDALNEAVNKTRQTEDLNSLNRNNLEESQQKSRELQKQYGLVQETLR
MAENALAKVSNFLQKMESAKEAYEKLAALLDGAKLPLTERVKKFSPASSKIPIVEQAEEH
ARLLDELARNLSSIIQGTNQDGFIQRAIDASNVYASIIEAVGKAERAAHDADEAAGEALM
NVISENLGAISKELKRNSSNLEEGVRREQTKLNGAIKGTLQAAKEKLADIRRKKEQLLSQ
LQSVQDTLGRDQEDTKETIQNAKAAATEANETTARVEDTLSTMKKNLDEWKDKYGGLRSE
DLNQAVQDARKSVSSLESTIPLLLGKLSSLENRRNKNATVSENIVRIRQLITQARNAASK
VKVPMKFNGSSGVQVRMPSNLQDLAAYTSLKFYIQNPEPRSQQDGAEEGRFILYLGSREA
TGDYLGIVLKDRKVQWVYKLGNEEPASLTVDEEIGEQFAAININRILQYGQMSVIVERQT
VHETKGDSVAKGEQGLLNLDPHNVVFYVGGYPPSFMPPPTLRYPNYRGCLELDTLNEEVV
SLYNFQHTFQLDTTAEKPCARSKSTGDPWLTDGSYFDGTGYAEIKFESQFGTTKRFEQEI
RIVSYNGILFFLENQGQFLCLAIRDGKLVLYYDFSTGLEMAKPSSNSSSISSATNKAIQI
FLLKMNNKKRILVRLERLTIFMVEQENSLENAVSYYLGGVPPAVLPPSLKALFPTGGPIR
GCMKGLKALGKYVDLKRMNTVGVSYGCTSDLLVARSISVHGYGYLTLALKDVPALRNFYS
GFSFQTSQREGLLYYHSTQEGTCQVSLQRGQLALNLLETKVTTENTYADDRTHYVAFYSD
TRGVRLYVDDELQDTAAGARASWRQRRQQDDRALFQLGGSAEPGALSNLTGCIGNVFVKR
ISEPQMVVDLQQNVESINVTMSCPWGERPQQLRVALKKVSSRPSSKDRRHDQAGLCRPQP
RTARDTFRFGGSPSSRWEFEEIPASFSQRFHFSLEVRLNSSNGLLFYVAGKRSTFMALLV
SNGRFIFLVAIGGRRLRIRSKEKYHDQRWHTVFFSRDQSRVHLVIDGLRAQSATVATAEL
FVAQTPLYIGGVPEGRAKAHMLGTSVSSFDGCLRNPQLDGKLLGTPSHTFGVTPCYEGAV
EHGIFFAADGGSVTLADALATEQDLEVTLEVRPHSASGLIFHIGTRRSPHLVLYMEETKV
TMRANSGAEEFSTSVTCPSLCDGQWHSITAIKRKNIIQVEVDTERNYAVGPSRPPAPSAR
AMFYLGGLPEADEASTVSALPPLPHYVGCIRNLLVNQSYVNLLQTRTVRGSVGLKGCP
Download sequence
Identical sequences G1N210
ENSMGAP00000005615 ENSMGAP00000005615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]