SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N2X8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N2X8
Domain Number 1 Region: 106-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.4e-35
Family BAR domain 0.0076
Further Details:      
 
Domain Number 2 Region: 5-71
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.9e-21
Family DBL homology domain (DH-domain) 0.0011
Further Details:      
 
Domain Number 3 Region: 445-502
Classification Level Classification E-value
Superfamily SH3-domain 7.61e-17
Family SH3-domain 0.00023
Further Details:      
 
Domain Number 4 Region: 348-433
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000158
Family SH3-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1N2X8
Sequence length 508
Comment (tr|G1N2X8|G1N2X8_MELGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMGAP00000006026} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN= OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
GKPNLMDMGSLMIKPVQRVMKYPLLLCELLNSTPASHADHKALQEALSAMKNINVNINEL
KRRKDLVLKYKRNDDDETLKEKFSRLNIHSISKKSKRVTSHLKILTGGEPQVKDQTFNKE
EKLFRSLEKTVKSCVKNISLSLQHLQDSIHLAAQNITEIKSSSLEKTFSLTHQKLLSMCL
KNCENEMTQLDKVVLTPLSALQALFSGPQKLIQKRYDKLLDYNSYLQRSPGEELDLAKKD
YEALNAQLVEELQVFNRTAKKIVLNCLYCFITLLRSIMSAALQSNSAVVVPVPLSSSSIC
EVQHQLMEEVHKLNFMKENSSATFIERKLSLEKKKPVPSPLESPRQTEDHRSKLLSTYSA
ELLYQAKRKCNATQEFDIDLHEGEVVAVVEQKDPFQSTSRWLVDTGILKGYVYSSFLKPF
NPAKAQKDIAENNFCDDDFDNDMDDQHTFYAVYAFQARNDQELSLQEYEKVRILRFSDVS
GNKEWWLAEAKGQKGYVPSNYLGKMTYA
Download sequence
Identical sequences G1N2X8
ENSMGAP00000006026 ENSMGAP00000006026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]