SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N3S9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N3S9
Domain Number 1 Region: 204-512
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.39e-89
Family Protein kinases, catalytic subunit 0.0000000203
Further Details:      
 
Domain Number 2 Region: 26-148
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.7e-36
Family Synaptotagmin-like (S variant) 0.00000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1N3S9
Sequence length 542
Comment (tr|G1N3S9|G1N3S9_MELGA) Non-specific serine/threonine protein kinase {ECO:0000256|SAAS:SAAS01030073} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=PRKCB OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
CMMNVHKRCVMNVPXLCGTDHTERRGRIYIRADIEKDVLTVVVRDAKNLVPMDPNGLSDP
YVKLKLIPDPKNESKQKTKTIKCSLNPEWNETFRFQLKEADKDRRLSVEIWDWDLTSRND
FMGSLSFGISELQKSGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEELRQKFERAKIGTGS
KAADEKMTNAISKFDNNGSRDRMKLSDFNFLMVLGKGSFGKVMLAERKGTDELYAVKILK
KDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYQIQQ
VGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWD
GVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIM
EHNVAYPKSMSKEAVAICKGLMTKHPAKRLGCGPEGERDIKEHAFFRYIDWDKLERKEIQ
PPFKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFFNSEFFKPEAKRA
AV
Download sequence
Identical sequences G1N3S9
ENSMGAP00000006404 ENSMGAP00000006404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]