SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N407 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N407
Domain Number 1 Region: 599-767
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000701
Further Details:      
 
Domain Number 2 Region: 41-239
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-43
Family DBL homology domain (DH-domain) 0.00041
Further Details:      
 
Domain Number 3 Region: 255-324,382-416
Classification Level Classification E-value
Superfamily PH domain-like 3.67e-20
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 4 Region: 459-574
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000312
Family Synaptotagmin-like (S variant) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1N407
Sequence length 815
Comment (tr|G1N407|G1N407_MELGA) Active BCR-related {ECO:0000313|Ensembl:ENSMGAP00000006503} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=ABR OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
RALGANVPPLSPQLSRRAQPQGKQEEPMTNGGNEPAGERDAGKGLEMRKLVLSGFLASEE
IYINQLEALLLPMKPLKATATTSQPVLTLQQIETIFYKIQDIYEIHKEFYDNLCPKVQQW
DSNITMGHLFQKLASQLGVYKAFVDNYKIALETAEKCSHSNNQFQKISEELKVKGPKDSK
ESHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPSDHPDYPLLQDALRISQNFLSSINED
IDPRRTAVTTPKGETRQLIKDGFLVELSEGSRKLRHVFLFTDVLLCAKLKKTAVGKHQQY
DCKWYVPLADLVFPSPEESEHCPQVHVIPDHELEDMKMKISAIKSEVQKEKANKGQSRAI
ERLKKKMFENEFWLLLNSPAIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQA
FVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYC
TLEVDSFGYFVSKAKTRVFRDTTEPQWNEEFEIELEGSQSLRILCYEKCYDKTKLNKDNN
EIVDKIMGKGQIQLDPQAVQTKNWHMDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGV
FGVKISVVTKRERSKVPYIVRQCIEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKD
ILVMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSL
PDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEGESKGHLTLASDIWS
HDVMAQVQVLLYYLQHPPISFTELKRNTLYFSTDV
Download sequence
Identical sequences G1N407
ENSMGAP00000006503 ENSMGAP00000006503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]