SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N4L9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N4L9
Domain Number 1 Region: 12-311
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.51e-88
Family AstE/AspA-like 0.000000000478
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1N4L9
Sequence length 317
Comment (tr|G1N4L9|G1N4L9_MELGA) Aspartoacylase {ECO:0000313|Ensembl:ENSMGAP00000006803} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=ASPA OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
LKSMTSCSVVPKPPVRRVAIFGGTHGNELSGIFLVKHWQENGAEIQRAGMEVKPFLTNPR
AVKKCTRYIDCDLNRVFDPDNLGQTVVEDIPYEVRRAQEINHIFGPKGSDDAYDLIFDLH
NTTANMGGTLILENSRDDFTIQMCHYIKNALAPERVPVLLIEHPNLKYATTRSVAKHPVG
VEVGPQPQGVVRADILDKMRKIVKHGLDFVHLFNEGKEFPPCTIEVYKIMEKVDYPRNKN
DEVIAIIHPKLQDQDWQPLNNGDPLFLTLDGEVIAYKGDCTVYPTFINEAAYYEKKQAFV
KTIKMELTAEHIRSSVV
Download sequence
Identical sequences G1N4L9
ENSMGAP00000006803 ENSMGAP00000006803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]