SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N4R7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N4R7
Domain Number 1 Region: 187-389
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-52
Family DBL homology domain (DH-domain) 0.00000131
Further Details:      
 
Domain Number 2 Region: 2-212
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.24e-35
Family Calponin-homology domain, CH-domain 0.0032
Further Details:      
 
Domain Number 3 Region: 376-538
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-33
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 4 Region: 656-757,805-831
Classification Level Classification E-value
Superfamily SH2 domain 7.69e-25
Family SH2 domain 0.00088
Further Details:      
 
Domain Number 5 Region: 559-649
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-16
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 6 Region: 758-833
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000048
Family SH3-domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1N4R7
Sequence length 837
Comment (tr|G1N4R7|G1N4R7_MELGA) Vav guanine nucleotide exchange factor 2 {ECO:0000313|Ensembl:ENSMGAP00000006863} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=VAV2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MEEWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLPGSIDLKDIN
FRPQMSQFLCLKNIRTFLKVCHDKFGLRNSDLFDPFDLFDVRDFGKVISAVSRLSFHSIA
QTKGIRPFPSEETTENDDDVYRSLEELADEHDLGDIYDCVPCEDEGDDIYEDIIRVEVQQ
PMKMGMTEDDKRNCCLLEIQETEAKYYKTLEDIEKNYMNPLKLVLTPQDMEAIFINLEDL
IKVHFNFLRAIDVSMMSGGSSLAKVFLEFKERLLIYGKYCSHMEYAQNTLNHLIANRDDV
RQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSSDRPEKQQLKEALEAMQ
DLAMYINEVKRDKETLKKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYL
FLFDKVVIVCKRKGYNYELKEIIELLFHKMTDDPMNNKDIKKWSYGFYLIHLQGKQGFQF
FCKTEEMKRKWMEQFEMAMSNIKPEKANANHHSFQMYTFEKTTNCKACKMFLRGTFYQGY
LCPKCGAGAHKECLEIIPPCKMGSSADQDLLSAGPGPKMVAVQNYHGNPAPPGKPVLTFQ
IGDVIELLRGDPDSPWWEGRLLQTKKSGYFPSSSVKPCPVDARPPNSRPPSREIDYTVYP
WFAGNMERQQTDNLLKAHVSGTYLIRERPAEAERFAISIKFNEEVKHIKVVEKDNWIHIT
EAKKFESLLELVEYYQNHSLKESFKQLDTTLKYPYKSRERSTSRTFTRSPVFTPRVIGTA
VARYNFAARDMRELSLREGDVVKIYSRIGGDQGWWKGETNGRVGWFPSTYVEEEGVQ
Download sequence
Identical sequences G1N4R7
ENSMGAP00000006863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]