SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N518 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N518
Domain Number 1 Region: 312-478,869-1045
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 9.81e-124
Family Mammalian PLC 0.00000547
Further Details:      
 
Domain Number 2 Region: 622-737
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-30
Family SH2 domain 0.000015
Further Details:      
 
Domain Number 3 Region: 521-618
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-25
Family SH2 domain 0.00048
Further Details:      
 
Domain Number 4 Region: 1062-1185
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.56e-24
Family PLC-like (P variant) 0.0024
Further Details:      
 
Domain Number 5 Region: 17-130
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-22
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 6 Region: 765-830
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-18
Family SH3-domain 0.00022
Further Details:      
 
Domain Number 7 Region: 160-309
Classification Level Classification E-value
Superfamily EF-hand 0.0000000352
Family EF-hand modules in multidomain proteins 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1N518
Sequence length 1265
Comment (tr|G1N518|G1N518_MELGA) Phosphoinositide phospholipase C {ECO:0000256|RuleBase:RU361133} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=PLCG2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MPRKSIDYGELPEYEKSQIKRTLELGTVMTVFSIKKSSPERRTIQVIMETRQVAWSKTAD
KIEGFLDLMEIKEIRPGKNSKDFERCKAKHREEHCFTIFYGTQFVLNTLSLAADSKDDAD
KWLCGLNILYQEVMRAPTPAITESWLRKQIYSVDQTRRNSISLRELKAILPQVNFKVSSM
KFLKDKFAEIGAHKEELSFEQFHLFYKKIMFEQQKSXLDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQESWAQDLSKVRERMTEFVDDTMRETAEPFLFVDEFLTYLFAKENS
IWDEKYDTIDVQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYVRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVASEYPVILSIEEHCSVEQQRHMAKV
FKEVFGDQLLMKPVEASADQLPSPTQLKEKIIIKHKKLGPKGDIDVNLEDKKEEKKQQGE
LYMWDAIEQQWTRHYCAIADGKLSFSDVIEQNAEEDSSKEVKHTELHLKEKWFHGKMKEG
RTTAEKLLQEYCAEMGGKDGTFLVRESEAFPNDCTLSFWRSGRVQHCRIRSSSDGDTVKY
YLTDNVTFDSIYDLIQHYKEVHLRCAEFELRLTDAVPNPSPHENKDWYYSNLSRGEAEDM
LMRIPRDGAFLIRKRDEPDSFAMTFRAEGKVKHFRIQQEGRHFVLGTSAYFESLVELVTY
YEKHPLYRKMKLRYPVTEELLERYSTEKDINSLYDVKMYVEPSEISPTVPQRTVKALYDY
RAKRSDELSFCRGALIHNVTKETGGWWKGDYGEKVQHYFPSNYVEDLSNDNSAELESQII
EDNPLGSLCHGILVLNTYNVVKMPQGKHKKPFVFILEPKNPEDPCVEFATDKVEELFEWY
QSVREITWKTAEEENRRKYWEKNQLIAIELSDLVIYCKPTSKTKDNLENPDFKEIRSFVE
TKAESIVKQKPVELLKYNLKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
MQLNHALFSLNGRTGYVLQPESMRNEEYDPMPNESKRKLQMIMTVRVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLNPVWAPCPEQVKFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATFPIKGIKSGFRSVPLKNGYSEDIELASLLIHCEMQQVLEYEEELYSSC
RQLRKRQEELNNQLFLYDTHMNLRNPNRDALLREFNVNEHKLQMCQETCNRRLREKKVSN
SKFYS
Download sequence
Identical sequences G1N518
ENSMGAP00000006995 ENSMGAP00000006995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]