SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N5C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N5C9
Domain Number 1 Region: 189-354
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.4e-45
Family Ankyrin repeat 0.0000403
Further Details:      
 
Domain Number 2 Region: 1-74
Classification Level Classification E-value
Superfamily E set domains 5.37e-17
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1N5C9
Sequence length 357
Comment (tr|G1N5C9|G1N5C9_MELGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMGAP00000007149} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN= OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
QYAIVFRTPPYHKPKIDRPVTVFLQLKRKRGGDVSDSKQFTYYPVVEDKEEVERKRKKVL
PQFPQHFGGGSHMGGAGGAGGFGAGGGGNLSFPYSSGLGYNNLYSSSPHPVGGYQGGVQM
KASESGDGGDRQVPTESTYCRELQRHAHLCHLWLLARRNAHALLDYSVTADPRMLLAVQR
HLVASQDENGDTPLHLAIIHEQTAVIKQLIEVVVSIPSQQIINITNNLQQTPLHLAVITK
QPQVVQLLLQAHANPLLDRYGNSLLHLALQAGDEEMLRTLLAHLGSATPYLLCLPNFHGL
LPVHLAVKAKSLACLDLLVRKGADVNGVERQGGRTPLHLAVEMENLNMATHLVKKVG
Download sequence
Identical sequences G1N5C9
ENSMGAP00000007149 ENSMGAP00000007149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]