SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N5F0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N5F0
Domain Number 1 Region: 1167-1362
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000232
Further Details:      
 
Domain Number 2 Region: 957-1080
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-32
Family Pleckstrin-homology domain (PH domain) 0.00000113
Further Details:      
 
Domain Number 3 Region: 41-165
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-19
Family PDZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1N5F0
Sequence length 1994
Comment (tr|G1N5F0|G1N5F0_MELGA) Rho GTPase activating protein 21 {ECO:0000313|Ensembl:ENSMGAP00000007171} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=ARHGAP21 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MLCVVETFSSVLYTAVLNNFLREANASKNKDGKEQSEAISPSEEEEAFSWPGPKTVVLRR
TSQGFGFTLRHFIVYPPESAVQFSFKDEENGNRQGKQRNRLEPMDTIFVKQVKEGGPAFE
AGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDSMLELSVMPKDEDILQLLQFTKDVTAL
AYSQDAYLKGNEAYSGNAHNIPEPPPICYPRLTPTTSVVAQAGDKLSSSDFSLGKQQVSR
PVRALTQPERAYRMEIQVPPSPTDIAKSNTAVCVCNETVRTVIVPSEKAVDLPSCRNNHA
GPSHRTEEIRYGLKDQTTLKARTTSPSSSVSTAIVLPQTPLTRPGDPNGTVIKASNYVVC
PEGIPSTRPSVQATDSPSISTNHYSSPSSHQHIDWKNYKTYKEYVDNRRMHMYGSRTIQE
RLDSLRAASQNTTDYNQVVPNRTASQVRRRSTSHDRVPQSAQIRQRSVSQERLEDPVLMK
EWPRSASQDTLTSPSLSARNHRARSWDYLSKQGEMLENFHSENLIADTNGDRRKTYKWTG
FSEQDDRRGIYDRPRQHAFHMSLRGQNFPLGPSGYISDGRRVGSRASLPGSHFQKVSPDI
RMLQPSRELQTPGGISKPTAVSQERTSLITARSSKSSSLKNSSYAAKPSFPLNQSLDVVA
SKDQRTVNHLHQSGLLNQQSRTRGEAAPDHRTEMGKTMQPSSLSPTSAKLVQQTSESSTT
SDNTGVSIRKRSHDFEKENAHEPEILQTDVQGNDKDAVVMRDKSPSGHQTPQPLRHQSYI
LAVNDQEAASDTTCWLPNDARREVHIKRIEERKASGSTPPGDSLASIPFIDEPTSPSIDH
DIAHIPASAVISASASQAPAITTVPPSPTSPIPLIRRQLSHDHESIRPSILDSQPATKPE
RSKSYDEGLDDYRDEEKSSIKHVSSLKGIKVTDSQKSSEDSGSRKDSSSEVFGDASKEGW
LHFRQLVTDKGKRVGGSIRPWKQLYVVLRGHSLYLYKDKKEQMTPSEEEQPISINACLID
ISYCETKRKNVFRLTTSDCEYLFQAEDRDNMLAWIKAIQENSNLNDEDTGVTSRDLISRR
IKEYSTMMSKTEPSPKTPRQSLSIRQTLLGTKADQRTQSPHSPKDESERKLLTKDETSPP
KDKGTWRKGIPSIMRKTFEKKPSAVGTFGVRLDDCPPAHTNKYIPLIVDICCKLVEERGL
EYTGIYRVPGNNAAISSMQEELNKGMTDIDVHDDKWRDLNVISSLLKSFFRKLPEPLFTN
DKYADFIDANRKEDPVERLKTLKRLIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRN
LAIVFGPTLVRTSDDNMTHMVTHMPDQYKIVETLIQKHDWFFTEDDAEEPLTAVQEENTV
ESQPVPNIDHLLTNIGRTGVSPGDVSDSATSDSTKSKGSWGSGKDQYSKELLVSSIFAAA
SRKRKKTKEKPQPSSSEDELDNVFAKKELAEQSRGDAAKEDTAKGEYEKERDAGRKQRMF
VLKEKDSSSKKDVNVVKDEKKSLRKESLLSEEPSLPYHEKRTKSQSLSCQQTLQKHNPKM
PISQSSSQVEETVSDSGTMLSTSSQASQHRYSCKKITSPEIKHSEFLAADVSSITSDYST
TSSSIYITGLDASMLSPEVQSVTESKGEDADDERSELISEGRPMETDSESDFPVFATSSA
AERLSKGKVSEVFKSSRRNSEESEVSCTEGSSTPKLESRRLFSSHKLIECDTLSRRKSAR
HKTDSEGSGDAKSEKDLPTVTKMFDMMKKGRSTSSLATSARSETDKQEPTWRLKITDRLK
LRLKSSADDMFGVGNQKANSAETVKRKNIRRRHTLGGQRDFDEISVLNVWKVQEPSQSRE
RESELSAVNRLKPKCPAQDLSISDWLARERLRTSTTDLNTGETGKPRLENTSLADASKVD
LPLSAEMQADEGSSSSSLTSISRTPPSGPFQPPDQVNGESYQNMNKNNFSPAVDAHPHKL
SGTQVVRSRFYQYL
Download sequence
Identical sequences G1N5F0
ENSMGAP00000007171 ENSMGAP00000007171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]