SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N615 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N615
Domain Number 1 Region: 174-439
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.52e-72
Family Protein kinases, catalytic subunit 0.00000000084
Further Details:      
 
Domain Number 2 Region: 64-206
Classification Level Classification E-value
Superfamily SH2 domain 1.22e-39
Family SH2 domain 0.00000558
Further Details:      
 
Domain Number 3 Region: 7-89
Classification Level Classification E-value
Superfamily SH3-domain 2.27e-21
Family SH3-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1N615
Sequence length 450
Comment (tr|G1N615|G1N615_MELGA) Tyrosine-protein kinase {ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=HCK OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
AGSGDNVVLALYDYEAMHSGDLSFQKGEQLQVLEQLGEWWQARSLVTGRKGFIPSNFVAR
ANSLEAEEWFFKGISRKDAERQLLSPGNTLGSFMIRDSETTKGCYSLSVRDGDGLHGGSI
KHYRIRTLDSGGFYISSRSSFDTLQELVEHYKGQSDGLCQRLTYPCSVPKPQKPWEKDAW
EIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVSAFLEEANLMKSLQHD
KLVRLHAVVTREDQAERHAMPSGSLLDFLKSEEGNKQPLPKLIDFSAQIAEGMAFIEKRN
YIHRDLRAANILVSAMLVCKIADFGLARIIEDNEYVAREGAKFPIKWTAPEAINYGSFTI
KSDVWSFGILLTEIVTYGRIPYPGMSSAEVIRALEHGYRMPRTESCPEELYDVMMRCWKT
KPEDRPTFEYMQSILEDFFTATEGQYQQQA
Download sequence
Identical sequences G1N615
ENSMGAP00000007465 ENSMGAP00000007465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]