SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N621 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N621
Domain Number 1 Region: 265-566
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.29e-89
Family Protein kinases, catalytic subunit 0.0000000197
Further Details:      
 
Domain Number 2 Region: 99-225
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.14e-36
Family Synaptotagmin-like (S variant) 0.00000172
Further Details:      
 
Domain Number 3 Region: 41-96
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.93e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00018
Further Details:      
 
Domain Number 4 Region: 2-30
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000115
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1N621
Sequence length 616
Comment (tr|G1N621|G1N621_MELGA) Protein kinase C {ECO:0000256|PIRNR:PIRNR000550, ECO:0000256|SAAS:SAAS00929532} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=PRKCA OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
GFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHC
GSLLYGLLHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTGDKLEVTVR
EAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTFRSTLNPHWNESFTFKLKPTDKDR
RLSVEVWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPDADEDGN
AELRQKFEKAKLGPAGNKVITPSEDRSSSVPSNNLDRVKLTDFNFLMVLGKGSFGKVMLA
DRKNTEELYAIKILKKDVVIQDDDVECTMVEKRVLALQDKPPFLTQLHSCFQTVDRLYFV
MEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISVGLFFLHNRGIVYRDLKLDNVMLDSEGH
IKIADFGMCKEHMLDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQP
PFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGLEGERDIREHAF
FRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGF
SYVNPQFVHPLLENVA
Download sequence
Identical sequences G1N621
ENSMGAP00000007471 ENSMGAP00000007471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]