SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N6C2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N6C2
Domain Number 1 Region: 549-1024
Classification Level Classification E-value
Superfamily Ras GEF 5.89e-139
Family Ras GEF 0.0000000000000393
Further Details:      
 
Domain Number 2 Region: 5-159
Classification Level Classification E-value
Superfamily Histone-fold 1.23e-50
Family TBP-associated factors, TAFs 0.00000054
Further Details:      
 
Domain Number 3 Region: 180-382
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-42
Family DBL homology domain (DH-domain) 0.00000000525
Further Details:      
 
Domain Number 4 Region: 400-556
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-38
Family Pleckstrin-homology domain (PH domain) 0.000000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1N6C2
Sequence length 1313
Comment (tr|G1N6C2|G1N6C2_MELGA) SOS Ras/Rac guanine nucleotide exchange factor 1 {ECO:0000313|Ensembl:ENSMGAP00000007609} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=SOS1 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
WRRLELNAVGMVQVQVHPKLSSTEDALQYVEELILQLLNMLCQAQPRSFLDVEDRVQKSF
PHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYIS
ADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDVEDLSALTLSDEEPSTSGE
QTYYDLVKSFMAEVRQYIRELNLIIRVFREPYASNSKLFSSHDVENIFSRISDIHELSVK
LLGHIEDTVEMTDEGSPHPLVGSCFEDMAEELAFDPYESYAQDILRPGFHDHFLSQLSKP
GAAFYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDEEDKECLKQAIT
ALLNLQSSMERICSKSLAKRRLSESACRFYTQQMKGKQLAIKKMNEIQKNIDGWEGKDIG
QCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRLKEKFFMRK
VQINDKDDTNEYRHAFEIILKDENSVIFAAKSAEEKNNWMAALISLQYRSTLERMLDVTM
LQEEKEEQMRFPNPELYRFAEPDSEENIVFEENMQPKSGIPIIKAGTVVKLIERLTYHMY
ADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADRIAMENGDQPLSAELKRFR
KEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRLEEFIGTVRGKAMKKWVESITKIIN
RKKQAQAIGPSHNITFESPPPAIEWHISKPGHTETFDLLTLHPIEIARQLTLLESDFYRA
VQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETENLEERVIVVSRIIEI
LQVFQELNNFNGVLEIVSAMNSAAVYRLDHTFEQIPSRQKKILEEAYELSEDHYKKYLAK
LRSINPPCVPFFGIYLTNILKTEEGNPEFLKRHGKELINFSKRRKVAEITGEIQQYQNQP
YCLRVEFDIRRFFENLNPMGSSMETEFTDYLFNKSLEIEPRNVKPPPRFPKKYNYPLKSP
GVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETETTASAPNSPRTPLTPPPASATSST
TDACSVFDSDPSSPFHASKTMLSLLNMQGSSYFMVCFHFTKTSDEAHVPPPVPPRRRPES
APAESSPSKITSAHLDSPPAIPPRQPTSKVYSPRYSVPDRTCISDPPESPPVLPPREPVR
TPDVFSSSPLHLQPPPLGRKSELGNTFFPNSPSPFTPPPPQTPSPHVARRHLPSPPLIQQ
DVDLHSVAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMHRDGPPLLQNAHSS
Download sequence
Identical sequences G1N6C2
ENSMGAP00000007609 ENSMGAP00000007609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]