SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N704 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N704
Domain Number 1 Region: 162-191,386-622
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.82e-49
Family FolH catalytic domain-like 0.00000123
Further Details:      
 
Domain Number 2 Region: 217-404
Classification Level Classification E-value
Superfamily PA domain 7.46e-49
Family PA domain 0.00000123
Further Details:      
 
Domain Number 3 Region: 626-711
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 2.88e-18
Family Transferrin receptor-like dimerisation domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1N704
Sequence length 712
Comment (tr|G1N704|G1N704_MELGA) Transferrin receptor {ECO:0000313|Ensembl:ENSMGAP00000007940} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=TFRC OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MDHARAALSSLFSAEPMSYTRFSIARQTDGDNSHVEMKLSADDEEGVDIERPEHVHDSMA
QPQRNGKKLCFLVIAAVLLLLIGFLIGYLSYRGRMQLAARCQDGSGRCEITPTASYLVDG
DETVEEEIQGPPVIYWPQLKAMLSDKLLAKNLGDRLRQRAGLDSFEAGEAEDTNMATYIH
EQFNSFFLDKVWNDEHYIKLQIRGSTKNKVSVLINDSEEILEMPDAYVAYSESGSFSGKP
VYVNYGLKKDIETIQKSVTPLNGTIVIVRAGKITLAEKVANAKEAGAVGVLMYMDSFKYG
ITGTLTPFGHAHLGTGDPYTPGFPSFNHTQFPPVESSGLPHIAVQTISSSAAAKLFSKMD
GDSCSEDWKGGIHSCKVTTKQESKIMVKLDVNNSMKDRKILNIFGAIQGSEEPDRYVVIG
AQRDSWGPGVAKAGTGTAILLELARVISDIVKNEGYKPRRSIIFASWSAGDYGAVGATEW
LEGYSAMLHAKAFAYINLDAAVLGANHVKISASPLLYMLLERIMKGVKDPAQGSRTLLDR
VGSDWVKAVVPLGLDNAAFPFLAYSGIPVVSFGFYNKDEEYHFLNTKDDTLENLRKIDNL
DALLRAAAEVAGQVALRLTHDHELFLDFGRYGEELLAYQEKFLPYVKDVQELGLTLDWLF
ARGDFQRAADALRRDIANSDRENKVIRRALNDRIMKVEYDFLSPYLSPKEVP
Download sequence
Identical sequences G1N704
ENSMGAP00000007940 ENSMGAP00000007940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]