SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1N767 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N767
Domain Number 1 Region: 82-243
Classification Level Classification E-value
Superfamily EF-hand 3.63e-22
Family Calmodulin-like 0.0066
Further Details:      
 
Domain Number 2 Region: 2-62
Classification Level Classification E-value
Superfamily EF-hand 0.0000000132
Family Calmodulin-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1N767
Sequence length 249
Comment (tr|G1N767|G1N767_MELGA) Secretagogin, EF-hand calcium binding protein {ECO:0000313|Ensembl:ENSMGAP00000008022} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=SCGN OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
DNGYIEGKELDNFFHHLLEKLRPDDTITEEEVQRMKEQFMSAYDVTTDGRLQIQELANMV
LPDDENFLLLFRRETPLDNSVEFMRIWRSYDADSSGFISAGELKDFLRDLFLQHNKVVTE
VKLEEYTDTMMKIFDKNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFA
HYDVSKTGALEGPEVDGFVKDMMELVKPSISGVDLDKFRQILLNHCDVNRDGKIQKSELA
LCLGLKMNP
Download sequence
Identical sequences G1N767
ENSMGAP00000008022 ENSMGAP00000008022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]