SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N778 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N778
Domain Number 1 Region: 47-236
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.9e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 17-54
Classification Level Classification E-value
Superfamily PH domain-like 0.000000869
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1N778
Sequence length 660
Comment (tr|G1N778|G1N778_MELGA) Rho GTPase activating protein 24 {ECO:0000313|Ensembl:ENSMGAP00000008035} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=ARHGAP24 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
KVLQSSLAGGDRERMTANHETYLLMASTQNDMEDWVKSIRRVIWAPFGGGIFGQKLEDTV
RYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSN
TDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKMLSKEEEMGLIELVKQVKSLPAVNY
NLLKYICRFLDEVQSYSGINKMSVQNLATVFGPNILRPKVEDPLTIMEGESTVNNLKEVR
TDQHHLFFPSEQASMPHKPHNNSNFCKEAIAISLKEKWQLNYMQTGNCAMLWHSMELMQN
HNFRVSLINGCLSNNPLSVIGSQDVTRSPPLTVKKNPAFNKGSGIVTNGSFSSSVESHEK
SQTYQTVPCKPGEHPPLKGPVTKMGTQSMQNGGVRMGVSSTDGLTNTLNNRSPGWAPNGC
VTLRDNKQKESVSESGQHNRLSTYDNVHQQFSTVNSDDKQSVDSATWSTSSCEISLPEHS
NSCRSSTTTCPEQDFFAGNFEDSVLDGPPQEDLSNTGDYENRSDRRSVGGHSSRATSSSD
NSETFVANSTNNHSALHSLVSSLKQEMAKQKLEYETRIKSLEQRNLTLETEMIALHEELD
QERKKFTMVEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRPERGNTIWIQ
Download sequence
Identical sequences G1N778
ENSMGAP00000008035 ENSMGAP00000008035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]