SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N7V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N7V9
Domain Number 1 Region: 33-239,414-500
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.71e-60
Family Bacterial dinuclear zinc exopeptidases 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1N7V9
Sequence length 516
Comment (tr|G1N7V9|G1N7V9_MELGA) Carnosine dipeptidase 1 {ECO:0000313|Ensembl:ENSMGAP00000008322} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=CNDP1 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
QDFKLFEVNSAHLSLVLLSTARMSLSSFSVLETEIFRYIDAHQSDFIENLKEWVAVESDS
VQPELRKEVIRMMSLAAARLAALGATVNSVSLGSQQLLNGQHLPLPPVVLGELGKDPQNL
TICFYGHVDVQPAKKEDGWKTDPYTLTEINGNLYGRGATDNKGPVLAWINAVETFRAFKI
AMPVNFKFVIEGMEEAGSLGLEKLLEEEKQGFLSDVDYIVISDNLWLSKKKPALIYGTRG
NACFSVEVEGGDKDLHSGTFGGIIHEPLTDLIALLDSLVDPTGHIQIPGIYDAVAALTDE
DKKLYESIEYDIEEHKNNSGVKKLLFSTKKEEILLHLWHYPSLSIHGIEGAFHEPGIKTV
IPAKVIGKFSIRQVPNMDLSDVKQQVVDHLENVFAKRNSPNKLKVSMPLGAKPWVADVND
PLYKAAKRAIRTVFGEDPDFIRDGSTIPIARIFQTITQKRVIMFPIGAADDGEHSQNEKI
SRHNYIEGTKVFAAFFLEISKLRGQLHETSNPRTNN
Download sequence
Identical sequences G1N7V9
ENSMGAP00000008322 ENSMGAP00000008322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]