SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N8A6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N8A6
Domain Number 1 Region: 514-578,799-1134
Classification Level Classification E-value
Superfamily Ras GEF 7.59e-82
Family Ras GEF 0.00021
Further Details:      
 
Domain Number 2 Region: 198-293
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000000000119
Family DBL homology domain (DH-domain) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1N8A6
Sequence length 1137
Comment (tr|G1N8A6|G1N8A6_MELGA) Ras protein specific guanine nucleotide releasing factor 2 {ECO:0000313|Ensembl:ENSMGAP00000008523} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=RASGRF2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
YYFTVLFGHEGQKPLELRCEDEGDGDEWVEAIHQASYSDILIEREVLMQKYIHLVQIVET
EKIAANQLRHQLEDQDTEIERLKSEIIALNKTKERMRPYQGNQEDEDPDIKNSLEKVVSY
LRVWKCLKMWSFICHPNVHRAQSLRLHNFFSAALSELDLIPLGHLVLSASLHSVAAVLDS
LKFPVTFPVSFSLKLSDETIMFLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEF
VRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQVFHYYTETAYRH
LFSNYIDSNLLRILYILTWSLENEKYTAEVSSSYTEKQFILRQTLNRSLYNADCIEDAAG
QKRKINKLQTNRKKIARNSRVVLFLFFKHVHVVCEPGVHEALLLTTHALLSRIECTIHFL
IAPHNNHSFNGSSRNVGMLECKTQVKPVIEANFEMFINSMILQSENAYILEVSQCIDNIR
CNGLMTIVFEENSKVTVPHMIKSDARLHRDDIDICFSKTLNSCKVPQIRYASVERLLERL
TDLRFLSIDFLNTFLHTYRIFTTAAVVLEKLSDIYRRPFTSIPVRALELFFATGQNNRGE
YLADAKSPHLCRKFSSPPPLSLSRTSSPVRTRKLSLTSPLNSRIGALDLSTSSVASSPTS
TYSPATSPPPTGSKVPLDLSKGPSSPEQSPGSIEKCLVSLHETNQFSTVVGHFIKQYSDY
STSAMDTTELSPCRSPATPRHLRYRQPGGWQNSGVGNCVQTADNSHCAVSPASAFAIATA
AAGHGSPPXKENYRLWSLAKIGFNNSERVCDKEFIIRRAATNRVLNVLRHWVSKHSQDFE
LNNELKMNVLNLLEEVLRDPDLLPQERKATANILRALSQDDQDDTHLKIEDIIQMSECPK
PECFETLSAMELAEQITLLDHIVFRSIPYEEFLGQGWMKLDKNERTPCIMKTSQHFNDMS
NLVASQIMNYADVSSRANSIEKWVAVADICRCMHNYNGVLEITSALNRSAIYRLKKTWAK
VSKQAKVLMDKLQKTVSSEGRFNLRETLKKVCLPTQHNYVMLRTVHKQERTEKYEQILYG
TYEKLSKVSLLSREKTPENQSVFSAFQVTHYLLDKTLIIDEDTLYELSLKLEPRLPA
Download sequence
Identical sequences G1N8A6
ENSMGAP00000008523 ENSMGAP00000008523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]