SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N918 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N918
Domain Number 1 Region: 60-207
Classification Level Classification E-value
Superfamily EF-hand 5.98e-41
Family Calmodulin-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1N918
Sequence length 209
Comment (tr|G1N918|G1N918_MELGA) Calcium binding protein 1 {ECO:0000313|Ensembl:ENSMGAP00000008865} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=CABP1 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
IRHEEKTCYKAVQTSEEGPSEYQGPLMVLAQNCAVMHNLLGPACIFLRKGFAENRQPDRE
LRPEEIEELREAFKEFDKDKDGFINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHV
DFEDFVELMGPKLLAETADMIGVKELRDAFREFDTNGDGEISTSELREAMKKLLGQQVGH
RDIEEIIRDVDLNGDGRVDFEEFVRMMSR
Download sequence
Identical sequences A0A226NAJ0 G1N918
ENSMGAP00000008865 ENSMGAP00000008865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]