SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1N921 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N921
Domain Number 1 Region: 226-406
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.93e-26
Family Ankyrin repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 521-630
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000131
Family Second domain of FERM 0.0033
Further Details:      
 
Weak hits

Sequence:  G1N921
Domain Number - Region: 422-513
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0961
Family Ras-binding domain, RBD 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1N921
Sequence length 736
Comment (tr|G1N921|G1N921_MELGA) KRIT1, ankyrin repeat containing {ECO:0000313|Ensembl:ENSMGAP00000008870} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=KRIT1 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MGNPENIGNAYVAVIRPKNTASLNSREYRAKSYEILLLEVPIEGQKKKRKKVLLETKLQG
GTEITQSILDYVLEATKPISPANQGIKGKRVVLMKTFPLDGERAGQEASLYIVPTVVKDN
TKYTYSPGCPVFYCFQDIMRVCSESSTHFATLTARMLIALDKWLDERHTQSHSIPALFRP
SPLERIKTNVINPAYAIEPGQTESSLHMGYTALEIKSKMLALEKADMCIYNPLFGSDLQY
TNRVDKVVINPYFGLGAPDYSKIQIPKREKWQRSMSSVTEDKEHQWVDDFPLHRSACEGD
SDLLSHLLDKKFSVNQLDSDHWAPIHYACWYGKVEATRMLLEKGKCNPNLLNGQLSSPLH
FAAGGGHAEIVQILLNHPEIDRHITDQQGRSPLNVCEENKQNEWEETAKLLKDAVNKPYE
KARIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQLKPFHKP
LQHIRDWPEIFTELTNLDPQRETSQLFLRRDVRLPLEIEKKIEDPLAILILFDEARYNLL
KGFYTSPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPITKLKSKAPHWTNR
ILHEYKNLSTSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASSSSHKVIKVYV
GVNVKGLHLLNMETKALLLSLKYGCFMWQLGDGDTCFQIHSLENKMSFIVHTKQAGLIVK
LLMKLNGQLMPSERNE
Download sequence
Identical sequences G1N921
ENSMGAP00000008870 XP_010710883.1.16129 ENSMGAP00000008870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]