SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1N9I1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1N9I1
Domain Number 1 Region: 355-473
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.53e-32
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Weak hits

Sequence:  G1N9I1
Domain Number - Region: 49-90
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0994
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1N9I1
Sequence length 476
Comment (tr|G1N9I1|G1N9I1_MELGA) Smoothelin like 2 {ECO:0000313|Ensembl:ENSMGAP00000009072} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=SMTNL2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
TNTMASEIDNLSSREAKTVCEALGRYEDTLRGAVREIHVDIQVFKQGVSRQVDEVLRIAS
PLARSVSELQQENQRLRVQLERLARQVEALSRSAGLPQEWRDEAERSPPAVGSSSPVPAF
SADRFSNLAKLAVSGRSQSVDLDDHHKPEFRRVFSSSIIENGHQSSSGTRIVHQFLQSAV
NGIMSQNSSPEAHAPAMTLQMPHLPVTAVTRISEKFSGETIHSAGTTSASTGLLGQNQSK
NEMALKTSNQSLLEKYLEKLSSSFKFYLTQAKNVGKPSFVAPPSSPHFTNDTYCGATPKP
HSSPPTIHRQVERRRELVRSQTLPRTTGTQARKALFEKFEQDSGKGKGQSRPKLKRSQSF
GVASASSIKQILLDWCRSKTIGYKHIDLQNFSSSWNDGMAFCALVHSFFPETFDYNKLDP
ANRKQNFELAFTMAEKMAHCDRLIEVDDMMMMGHKPDPMCVFTYVQSLYNHLRRFE
Download sequence
Identical sequences G1N9I1
ENSMGAP00000009072 ENSMGAP00000009072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]