SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NA21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NA21
Domain Number 1 Region: 184-328,390-426
Classification Level Classification E-value
Superfamily ARM repeat 2.04e-47
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0015
Further Details:      
 
Domain Number 2 Region: 459-748
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.61e-39
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00022
Further Details:      
 
Domain Number 3 Region: 2-82
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.33e-23
Family PLC-like (P variant) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NA21
Sequence length 752
Comment (tr|G1NA21|G1NA21_MELGA) Phosphatidylinositol 3-kinase catalytic subunit type 3 {ECO:0000313|Ensembl:ENSMGAP00000009325} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=PIK3C3 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
SWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGMHDLKV
WPNVEADGSEPTRTPGRTSSTVSEDQMSRLAKLTKSHRQGHMVKVDWLDRLTFREIEMIN
EVGKSGRNTNFCFLLINFFCIMVDIFKYNVLYVNRKDGDESSPVLTSSEIVKIPDPQMSM
ENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNVSQSYHDLKKIINKEKSVGVSHKYL
FDLSFQALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHFTNPTVRRYAVA
RLQQADDEDLLMYLLQLVQALKYENFDDIKNGLEPSKRDSQGSMSESMTTSGTNGTEIDS
SQIMTPIPSVSSPPLTSKTKEVADNENLDQDLCTFLISRACKNSTLANYLYWYVDEIMHL
KQHTSEHSIQSIRGMYTNSKVLSHLSNSRVKGDKSVRVMRSLLAAQQTFVDRLVHVMKAV
QRESGNRKKKVNKRLENLSLVYQTFSVRNQEIQLTYFVPRAKIKKLFLYKKSKFLPVLLL
RRMKNSEMPHKMQHGSKDQKFLNVPHIWQKISKPQNFLKKMTLFNFLFHSVNLNFSLFLC
VLHLADNLDYSSMSSDPLWHSACEQKLRKGTCIDAYNLLVTAGYCVITYILGVGDRHLDN
LLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLH
LRRYSNLILNLFSLMVDANIPDIALEPDKTVK
Download sequence
Identical sequences G1NA21
ENSMGAP00000009325 ENSMGAP00000009325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]