SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NAP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NAP2
Domain Number 1 Region: 4-243
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.31e-60
Family BAR domain 0.0057
Further Details:      
 
Domain Number 2 Region: 345-525
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.83e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000124
Further Details:      
 
Domain Number 3 Region: 631-713
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-17
Family SH3-domain 0.0000395
Further Details:      
 
Domain Number 4 Region: 219-319
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000339
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1NAP2
Sequence length 714
Comment (tr|G1NAP2|G1NAP2_MELGA) Rho GTPase activating protein 26 {ECO:0000313|Ensembl:ENSMGAP00000009615} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=ARHGAP26 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
ISPLTDLSSAKRKFADSLNEFKFRCIGDAETDDEICIAKSLQEFATVLRNLEDERMRMIE
NASEVLITPLEKFRKEQIGAAKDAKKKYDKETEKYCGVLEKHLNLSSKKKESQLQEADSQ
VDLVRQHFYEVSLEYVFKVQEVQERKMFEFVEPLLAFLQGLFTFYHHGYELAKDFSDFKT
ELTISIQNTRNRFEGTRSEVESLMKKMKENPHEHKNISPYTMEGYLYVQEKRHFGTSWVK
HYCTYQRESKRITMVPFDQKSGGKGGEDEAVILKSCTRRKTDXXXXXYLWYSLSLCRPGV
ITMQALSEEDRRLWMEAMDGREPVYNSNKDNQSEGTAQLDNIGFSIIKKCIHAVETRGIN
EQGLYRIVGVNSRVQKLLSILMDPKTATETETEICAEWEIKTITSALKTYLRMLPGPLMM
YQFQRSFIKAAKLENQESRVSEIHSLVHRLPEKNRQMLHLLMNHLAKVADNHKQNLMTVA
NLGVVFGPTLLRPQEETVAAIMDIKFQNIVIEILIENHEKIFNTVPETPPSNSQLLLSRK
KSTDSKPPSCSERPLTLFHTAQPNEKQENRNSIINSSLESVISSNVNSFLNSNSAPQSNL
NSSDLELEVIKPNRPNSLPQNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPISSPLRK
ARALYACKAEHDSELSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL
Download sequence
Identical sequences G1NAP2
ENSMGAP00000009615 ENSMGAP00000009615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]