SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NAW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NAW8
Domain Number 1 Region: 7-90
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-22
Family PDZ domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1NAW8
Sequence length 640
Comment (tr|G1NAW8|G1NAW8_MELGA) PDZ domain containing ring finger 4 {ECO:0000313|Ensembl:ENSMGAP00000009711} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=PDZRN4 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
QLHLDEVELCRIGSQEKLGLTVCYRTDDEEDTGIYVSEVDPNSIAARDGRIREGDRILQI
NGQDVQNREEAVALLSSDECKKIVLLVARPELQLEEGWLDDERNEFLEELNLEMLEEQHN
EAMQYTANEVEQPKKHEEEDGTTDTATSSSNNHEKDSGVGPTDESLRNDESSEQENAPEE
QNGATLQSKRELGHSQDTLGSVELQCNESFVSGEYIESDFIGNPEEECERFRQLLELKCK
IRNHGEYDLYYSSSTIECNRREQDGVEHELQLLNEELRNIELECQNIMQAHRLQKVRDQY
GDIWALHDEGFRNYNTSIDVQRGKLDDILEHPEKSDKDSSSAYNTAESCRSTPLTVERSP
DNSLQRMISITNRKNLRSTIVANQSSSGQSNKETISVKTKPTEQNSTAEDTVLASENSKF
TDQEKQSTEHIPYLSPYHSSSYRYGNIPAHAKHYQSYMQLIQQKSAVEYAQSQLSLVSMC
KDSQKCAEPKMEWKVKIRSDGTRYITKRPVRDRILKERALKIKEERSGMTTDDDTMSEMK
MGRYWSKEERKQHLVRAKEQRRRREFMMRSRLECLKESPQSGSEGKKEINIIELSHKKMM
KKRNKKILDNWMTIQELMTHGAKSPDGTRVHNAFLSVTTV
Download sequence
Identical sequences G1NAW8
ENSMGAP00000009711 ENSMGAP00000009711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]