SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NBP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NBP4
Domain Number 1 Region: 264-402
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.12e-36
Family BCR-homology GTPase activation domain (BH-domain) 0.000000651
Further Details:      
 
Domain Number 2 Region: 14-149
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-28
Family SH2 domain 0.000000348
Further Details:      
 
Domain Number 3 Region: 197-258
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.59e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000647
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NBP4
Sequence length 402
Comment (tr|G1NBP4|G1NBP4_MELGA) Chimerin 1 {ECO:0000313|Ensembl:ENSMGAP00000010073} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=CHN1 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
TAVVLSDTDEYRPPVWKSYLYQLQQEAPHPRRITCTCEVENRPKYYGREFHGMISREEAD
QLLSVAEGSYLIRESQRQPGTYTLALRFGSQTRNFRLYYDGKHFVGEKRFESIHDLVTDG
LITLYIETKAAEYIAKMTINPIYEHIGYTTLNREPAHKKHMPTLRDAHDGKDSTGEDEVA
EKRLTSLVRRATLKENEHVPKYEKIHNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADCG
LNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHFTKRPMVVDMCIREIESRGLNSE
GLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDLPIPLITYDAY
PKFIESAKTTDPDEQLEILHEALKLLPPAHCETLRYLMAHLK
Download sequence
Identical sequences G1NBP4
ENSMGAP00000010073 ENSMGAP00000010073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]