SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NBS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NBS9
Domain Number 1 Region: 153-262,308-580
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-150
Family Myotubularin-like phosphatases 0.0000000263
Further Details:      
 
Domain Number 2 Region: 1114-1190
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.25e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 52-132
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000106
Family GRAM domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NBS9
Sequence length 1197
Comment (tr|G1NBS9|G1NBS9_MELGA) Myotubularin related protein 3 {ECO:0000313|Ensembl:ENSMGAP00000010124} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=MTMR3 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MDEETQHSLECIQANQIFPRKQLIREDENLQVPFIELHGESTEYVGRAEDAIIALSNYRL
HIKFKESVVNVPLQLIESVECRDIFQLHLTCKDCKVIRCQFSTFEQCQDWLKRLNNAIRP
PSKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKNEVERMGFDMNNAWRISN
INEKYKLCGSYPQEIIVPAWITDKELESVASFRSWKRIPAVVYRHQSNGAVISRCGQPEV
SWWGWRNADDEHLVQSVAKACASDSRSNSNKLMNGNCSRDFSNGGDLSDVEFDSSISNAS
GAESLAIQPQKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGMANIHSIRKSFQ
SLRLLCTQMPDPGNWLSALESTKWLQHLSVLLKSALLVVHAVDRDQRPVLVHCSDGWDRT
PQIVALAKLLLDPYYRTTEGFQVLVEMEWLDFGHKFADRCGHGENSDDLNERCPVFLQWL
DCVHQLQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFLCNNAKERGEKHTQERTCSVWSLL
RAANKAFKNLLYSSQSESVLYPVCHVRNLMLWSAVYLPCSSPSTPADDTCAPYPVPGSSP
EDQPLGRLPKTRSFDNLTTACDSSVPPSNRRSSDPSLNEKWQEHRRSLELSSLGNPGDDP
FDGDGLSKQGRALMGAELSVAAGVAEGQMENILQEATKEDVILEEHLRGSLETAGKGDEV
ALDKEKRTENLRGYVSELCEKAEDKGMVMNNPCPLSQGACELKGHQEEHTDLSNTIQKLP
QVKGLQTVPLESFVNRDAQKNVEEGVGKPEGEGESLHSVSHAGLLLPLTSLQEVRTSNIE
SSTETLTENEAKQELIPRGPCHRAHLMDNSADELSRITENRPEGESVIELQKLGTKAHRT
SGSGSTHVPMPSPCALPLAECKDEVVCNGELEPENKMTEKPAGLGIVQKYQATNGHCVNG
EDGRMKISLSRQVSAASCSSAQFHLRNLHHKWMMTHLGKQQAAGSPDQPARSHLDDDGMP
VYTDVIQQRLRQIETGHQQEVETLKKQLQELKSRLESQFLNSSLRLNGDYGDEVTSIPDS
ESNLDQNCLSRCSTEIFSEASWEQVDKQDTEVTRWLPDHLAAHCYGCDSAFWLASRKHHC
RNCGNVFCSSCCNQKVPVPSQQLFEPSRVCKSCYSSLHPSSASLDLELDKPITATSN
Download sequence
Identical sequences G1NBS9
ENSMGAP00000010124 ENSMGAP00000010124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]