SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1ND43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1ND43
Domain Number 1 Region: 68-173
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-33
Family Second domain of FERM 0.0000837
Further Details:      
 
Domain Number 2 Region: 2-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.34e-22
Family First domain of FERM 0.00092
Further Details:      
 
Domain Number 3 Region: 171-228
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000553
Family Third domain of FERM 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1ND43
Sequence length 229
Comment (tr|G1ND43|G1ND43_MELGA) FERM domain containing 5 {ECO:0000313|Ensembl:ENSMGAP00000010734} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=FRMD5 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
LQRDAKGQYLFDLLCHHLNLLEKDYFGIRFVDPDKQRHWLEFTKSVVKQMRAQPPFTMCF
RVKFYPTDPAALKEEITRYLVFLQIKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGK
HPEGYSSKFQFFPKHSEKLERKIAEIHKSELSGQTPATSELNFLRKAQTLETYGVDPHPC
KDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKMKFEGKTFYLYVS
Download sequence
Identical sequences G1ND43
ENSMGAP00000010734 ENSMGAP00000010734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]