SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NDC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NDC8
Domain Number 1 Region: 888-1117
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-36
Family DBL homology domain (DH-domain) 0.0027
Further Details:      
 
Domain Number 2 Region: 1272-1470
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-31
Family Pleckstrin-homology domain (PH domain) 0.00013
Further Details:      
 
Domain Number 3 Region: 1103-1219
Classification Level Classification E-value
Superfamily PH domain-like 6.17e-23
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1NDC8
Sequence length 1472
Comment (tr|G1NDC8|G1NDC8_MELGA) FYVE, RhoGEF and PH domain containing 5 {ECO:0000313|Ensembl:ENSMGAP00000010845} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=FGD5 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
KPPLAPKPKIIGHLSPVAISKFSPSLPRSDILHNPNSVSRGPKPPIAPKPKLSTDTESRS
SVNANNNLNKCSSCKLLCFDGELYDGNQCSAECPESEADNEYIVLPETQLTIENCNDLEH
EHDQSIDSFAENEVLEIPEEGEKEEDNIPYHAGADRQEIKHRNFSDIAESIKPDCVSSTR
DRGQSEAFCEESSSATGLEKSEEEEEEEEELPEILREGDRCPAHDSDPSVYAELDLNMEK
ELENDDCTSPDMLPNEASEKTVLCLELPEGEPNAENDLGDSTHQAAAEEEEADTDKHNNT
NTGNASDDCQITDLRGEETSEVACEASKDSGKGEEETVNAESIDDECQIAPFENDDGEKV
PTNLQTEETCPKEGSQISDTLPSGPGMEPKLEDMSAEEHNESIAEISKSDELQLEGNEEN
LALPEVVIVPEESERRETGSDSLDDPYVLPAENEFTHKGQTDSGTDHSKRDELGTDGESN
LLPIDRKSIVTRTRSLSGKMPGYVPETVPEEGGPETDLPPSCNSSGTEDLSSNSFSVEGK
TMEDNKALPSKPRRFILYPRSYSVEGREIPVSIYKEGDGCVLSDIRMKKTEDNLSLPCVN
GSSHIFYQGNLSSGAVSTPSSVVDIPPPFELAYITKKPITKSSPSLLIESESPDKYSKKK
KSSFKRFLTLKFKKKTENKIHVDVNVSSSRSSSESSYHGPPRLMELDRTLSSSPQLKSHV
GKLRASESPSTVLFYKDGKRKGTPKSFSRSVSRVESFEDRSRPPFMPLPLTKPRSISFPN
ADTSEYENIPAMSSDYENIQIPPRRSTRAGTFTEFFEDPSRALSAANENDGYVDMSSFTG
FENKQQTTDQETESAYTEPYKVCPVSVIPVEVITSDEEQKSSEDEKSSQDDPSLINKKEG
QPRASLIAQELMSSEKAYVEMLQLLRMDLYEGILKALGEEDEQEVIELKKGLSKLPEMYE
LHQEILGELEERVLKCFSFCGFREEHQKVADVFLSRKSRLNHHTAYIMQFDKNLALLDET
CLKYSQLATVIQEFEKSCGGSPQNVKHQLLKVVQRVFQYRVMLTDYLNNLCPDSMEYEAT
QAALFIVSEITDRANESMLQGENLQKLVHIEHSVRGQSGLLQPGRIFVKEGTLMKVSGKN
RHPRHLFLMNDVLLYTYPQKDGKYQLKNTLVVSDIKVSRPVTEKAPNVLKIECDEYCLTL
SASSCLERDDWYSCISRHIPDDYKAHNTSTFHSNVELRERLGIPLGERPPTFVPVSHVMM
CMNCGCDFTLTLRRHHCHACGKIVCRNCSRNKYPMKYLRDQAAKVCDSCYVELKKRVNYP
LKLPERPLSMSFPPTSSRCSSSAFSSVFHNIHYSSFKKQKKIPSALTEVTASGEGATISG
YLSRCKRGKRHWKKRWFVIKGKVLYTYIANEDKVATESLPLLGFTVAPEKEEGCVGTVFH
LYHKQTLFYSFRADDNYSAQRWIEAMEEASIL
Download sequence
Identical sequences G1NDC8
ENSMGAP00000010845 ENSMGAP00000010845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]