SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NDY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NDY4
Domain Number 1 Region: 4-117
Classification Level Classification E-value
Superfamily PH domain-like 2.44e-37
Family Pleckstrin-homology domain (PH domain) 0.00000151
Further Details:      
 
Domain Number 2 Region: 179-244
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-16
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NDY4
Sequence length 245
Comment (tr|G1NDY4|G1NDY4_MELGA) Src kinase associated phosphoprotein 2 {ECO:0000313|Ensembl:ENSMGAP00000011098} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=SKAP2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
GNQFPPIAAQDLQFVLKAGYLEKRRKDHSFLGFEWQKRWCAISKTVFYYYGSDKDKQQKG
EFALEGYTIRMNNSLRKDAKKDCCFEISAPDKRIYQFTAATPKEAEEWVQQVKFVIQDME
SNTIPEEEEEYDDVGHASSEPIDDSIYEELPVNQKENAPPKTEMPKKWSQEKVDAASDGK
NTDYANFYQGLWDCTGDVPDELTFKRGDVIYILSKEYNRFGWWVGEMKGTIGLVPKAYIM
EMYDI
Download sequence
Identical sequences G1NDY4
ENSMGAP00000011098 ENSMGAP00000011098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]