SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NEI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NEI7
Domain Number 1 Region: 262-440
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000021
Further Details:      
 
Domain Number 2 Region: 2-162
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.33e-35
Family BAR domain 0.01
Further Details:      
 
Domain Number 3 Region: 136-237
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-16
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NEI7
Sequence length 670
Comment (tr|G1NEI7|G1NEI7_MELGA) Oligophrenin 1 {ECO:0000313|Ensembl:ENSMGAP00000011348} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=OPHN1 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
QERKKKFEKDGEKFYSMLDRHLHLSSKKKESQLQEADLQVDKERHNFFESSLEYVYQIQE
VQESKKFSIVEPVLAFLHSLFTYNNLTVELTQDFLPYKQQLQLSLQNTRNHFSSTREELE
DLKKRMKEAPQTCKLPGQPTIEGYLYTQEKWALGISWVKYYCQYEKEAKTLRMTPIDQKP
GAKQGTLDLTLKSCVRRKTDSIDKRFCFDIETNERSGTITLQALSEANRRLWMEAMDGKE
PIYHSPITKQEEMELNEVGFKFVRKCINAVETKGISTEGVYRTVGSNIQVQKLLNAFFDP
KCPGDVDLQSSDWDIKTITSSLKFYLRNLSEPVMTYKLHKELVLAAKSENLDYRLGAIHA
LVYKLPDKNREMLELLIRHLVNVCEHSRENLMSPSNMGVIFGPTLMRAQEDTVAAMMNIK
FQNIVVEILIEHFGKIYSGPPEDSAAPPVPPPRVAARRHKPITISKRPLRERPVFFGASV
EESGAQTLTGRMALPAQPDPQRQHHHGGPQTSAAQPPARAAAGGEEAGRPPAELEVGKVT
ARLQDGAVKLPGKAANGVVSSPALRTSTLHARRPAPRPGGCGRDGEYDGVPKPRPHGDKP
VITRPPVRPPDPPCRAPIPQKLEQRPDLIAGTAEEMPSSVVASRTKFFETASRRTSSSSS
PQGRIPGDES
Download sequence
Identical sequences G1NEI7
ENSMGAP00000011348 ENSMGAP00000011348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]