SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NEV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NEV6
Domain Number 1 Region: 253-345
Classification Level Classification E-value
Superfamily EF-hand 5.23e-26
Family Eps15 homology domain (EH domain) 0.0000138
Further Details:      
 
Domain Number 2 Region: 110-213
Classification Level Classification E-value
Superfamily EF-hand 4.62e-24
Family Eps15 homology domain (EH domain) 0.00000873
Further Details:      
 
Domain Number 3 Region: 11-103
Classification Level Classification E-value
Superfamily EF-hand 1.3e-18
Family Eps15 homology domain (EH domain) 0.0000267
Further Details:      
 
Domain Number 4 Region: 371-480
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000011
Family Myosin rod fragments 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NEV6
Sequence length 918
Comment (tr|G1NEV6|G1NEV6_MELGA) Epidermal growth factor receptor pathway substrate 15 {ECO:0000313|Ensembl:ENSMGAP00000011498} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=EPS15 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
KGAEMQIFMLSSANPVYEKFYRQVDSANTGRVLASDAAVFLKKSGLTDLVLGKIWDLADT
DSKGILNKQEFFVALRLVACAQNGLDVSLSSLNLPVPPPRFTDTSSPLLLSGTASSDIPW
AVKLEDKAKYDAIFDSLNPVNGLLSGDKVKPVLLNSKLPVDILGRVWELSDIDRDGMLDR
DEFAVAMFLVYCALEKEPVPMSLPAALVPLSKRKPVSVPGAMPLIPSSASSKDSHQSLPP
VGILAAKTPLTQWVVSPADKIKYDEIFVKTDKDMDGFVSGVEARELFLKTGLPSALLAHI
WALCDTKDCGKLSKEQFALAFYLINQKLTKGIDPPQALTPEMIPPSDRSVTLQKNVQGLN
SVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKEDTIKQRTSEVQDLQDEVKRESSNL
QKLQAQKQEAQEILNDLDEQKAKLEEQLNDIRQKCAEEAHLIAMLKAEITSQESKISAYE
DELTKAQEELSRLQQETAELEHCIESGKAQLGPLQQHLQDSQQEINSVQTKLLELKELES
NQFSWHSQPQTVLVNGTADHSSLSNSSSETANLNENAERESIAEDEQINNVSPTRNSPET
TAAAAEEDKETPSATVTKKEDPFDAESHPLPDIVSETSLEFFQSDPFVGSDPFKDDPFGK
IDPFGGDPFKGSDPFAADCFFKQSSTDPFVTAGTDPFSAAINSNNSTTEIPKKNDPFAPG
GTTVTTSNDSATDPFASLFGNESFGSGFADFSTMSKANNEDPFGSSTSGSVKNVVITKNS
FEEPPAKNEDVPPALPPKTGTPTRPCPPPPGKRPINQIDSSDSFKPRDPFQPFPTPEIPK
EQEADLFCDPFAPTSIGKEADPNNFANFSTYSTEEDMIEWAKRESEREEKERLARLKQQE
QEDLELAIALSKSELSEA
Download sequence
Identical sequences G1NEV6
ENSMGAP00000011498 ENSMGAP00000011498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]