SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NF23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NF23
Domain Number 1 Region: 145-437
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 3.79e-96
Family Cryptochrome/photolyase FAD-binding domain 0.0000127
Further Details:      
 
Domain Number 2 Region: 1-162
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 1.57e-31
Family Cryptochrome/photolyase, N-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NF23
Sequence length 521
Comment (tr|G1NF23|G1NF23_MELGA) Cryptochrome circadian regulator 2 {ECO:0000313|Ensembl:ENSMGAP00000011577} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=CRY2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
RFLLQSLEDLDNSLRKLNSRLFVVRGQPTDVFPRLFKEWGVTRLTFEYDSEPFGKERDAA
IIKLAKEAGVEVVVENSHTLYDLDRIIELNGNKPPLTYKRFQAIISRMELPKKPVSSIVS
QQMETCKVDIQENHDDMYGVPSLEELGFPTDGLAPAVWQGGETEALARLDKHLERKAWVA
NYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWELYKKVKRNSTPPLSLYGQLLW
REFFYTAATNNPKFDRMEGNPICIQIPWDKNPEALAKWAEGKTGFPWIDAIMTQLRQEGW
IHHLARHAVACFLTRGDLWISWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHC
YCPVGFGRRTDPSGDYVKRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPKPMVN
HAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSGPVTDSAPGQGSSSSTAIRLP
QSDQASPKRKLEGAEELCTEELYKRAKVTGLPSPEIPGKSS
Download sequence
Identical sequences G1NF23
ENSMGAP00000011577 ENSMGAP00000011577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]